Search results for " Myocardial infarction"

showing 10 items of 247 documents

CD14 C(-260)>T gene polymorphism is not a risk factor for myocardial infarction

2002

gene polymorphism risk factors myocardial infarction
researchProduct

Role of gene polymorphisms IL 10 (-1082 G/A) and TNFa (-308G/A) in susceptibility to acute myocardial infarction in young man.

2011

gene polymorphisms IL10 (-1082 G/A) and TNF a (-308G/A)acute myocardial infarctionSettore MED/05 - Patologia Clinicayoung man.
researchProduct

Prothrombotic gene variants in AMI young women

2012

gene variant myocardial infarction
researchProduct

IN-HOSPITAL COMPLICATIONS OF ACUTE MYOCARDIAL INFARCTION IN HYPERTENSIVE SUBJECTS

2005

BACKGROUND: Recent studies have shown a worse in-hospital outcome in hypertensive than in normotensive patients with acute myocardial infarction (AMI), which has been attributed to more frequent complications. The aim of this study was to investigate clinical patterns, risk factors, and in-hospital complications in hypertensive and normotensive patients with AMI. METHODS: Of 4994 consecutive patients with AMI admitted to the intensive care unit, hypertensive patients with first infarction (n = 915; mean age 68.8 +/- 11.4 years) and 915 gender- and age-matched normotensive subjects were retrospectively studied. RESULTS: In the univariate analysis, hypertensive subjects presented more frequen…

hypertension myocardial infaction compllicationsacute myocardial infarction
researchProduct

Plasma Viscosity and NLR in Young Subjects with Myocardial Infarction: Evaluation at the Initial Stage and at 3 and 12 Months

2018

In the “Sicilian study on juvenile myocardial infarction,” we had evaluated plasma viscosity (PV) and neutrophil/lymphocyte ratio (NLR) in patients with acute myocardial infarction (AMI) at the age of ⩽45 years. Now, we examined the relationship between these 2 parameters in 120 subjects (109 men and 11 women) aged ⩽45 years with recent AMI. The patients were classified according to the number of cardiovascular risk factors, the electrocardiographic criteria (ST-segment elevation myocardial infarction [STEMI] or non-ST-segment elevation myocardial infarction [NSTEMI]), and the extent of coronary stenosis, evaluated with coronary angiography. On fasting venous blood, we measured PV at the sh…

lcsh:Diseases of the circulatory (Cardiovascular) systemmedicine.medical_specialtySettore MED/09 - Medicina Internabusiness.industryLymphocytefungimedicine.diseaseneutrophil lymphocyte ratiomedicine.anatomical_structurelcsh:RC666-701Internal medicinecardiovascular systemCardiologyMedicineplasma viscosityIn patientcardiovascular diseasesMyocardial infarctionjuvenile myocardial infarctionStage (cooking)Cardiology and Cardiovascular MedicinebusinessPlasma viscosityOriginal ResearchClinical Medicine Insights: Cardiology
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Variations in plasma lipids and in the LDL peak particle size after acute myocardial infarction

2002

lipids LDL acute myocardial infarction
researchProduct

Comparison of frequency domain measures based on spectral decomposition for spontaneous baroreflex sensitivity assessment after Acute Myocardial Infa…

2021

Abstract The objective of this study is to present a new method to assess in the frequency domain the directed interactions between the spontaneous variability of systolic arterial pressure (SAP) and heart period (HP) from their linear model representation, and to apply it for studying the baroreflex control of arterial pressure in healthy physiological states and after acute myocardial infarction (AMI). The method is based on pole decomposition of the model transfer function and on the following evaluation of causal measures of coupling and gain from the poles associated to low frequency (0.04−0.15 Hz) oscillatory components. It is compared with traditional non-causal approaches for the sp…

medicine.medical_specialty0206 medical engineeringBiomedical EngineeringHealth Informatics02 engineering and technologyAcute myocardial infarctionBaroreflexSettore ING-INF/01 - ElettronicaMatrix decomposition03 medical and health sciences0302 clinical medicineInternal medicinemedicineSpectral analysiscardiovascular diseasesMyocardial infarctionSensitivity (control systems)Spectral decompositionbusiness.industryHead-up tiltLinear modelBaroreflexmedicine.disease020601 biomedical engineeringFrequency domainCausalityBlood pressureFrequency domainCardiovascular controlSignal ProcessingSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaCardiologybusiness030217 neurology & neurosurgery
researchProduct

Characteristics of patients from the Polish Registry of Acute Coronary Syndromes during the COVID-19 pandemic: the first report

2021

medicine.medical_specialty2019-20 coronavirus outbreakInfection ControlCoronavirus disease 2019 (COVID-19)business.industrySARS-CoV-2Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)COVID-19Retrospective cohort studyMiddle AgedPandemicEmergency medicinemedicineInfection controlHumansST Elevation Myocardial InfarctionPolandRegistriesAcute Coronary SyndromeCardiology and Cardiovascular MedicinebusinessNon-ST Elevated Myocardial InfarctionPandemicsAgedRetrospective StudiesKardiologia Polska
researchProduct

“Ultra-sensitive” cardiac troponins: Requirements for effective implementation in clinical practice

2018

The measurement of cardiac troponins, either cardiac troponin I or T, has become the culprit of clinical decision making in patients with suspected acute coronary syndrome (ACS), especially in those with non-ST elevation myocardial infarction (NSTEMI). The leading analytical mainstays of cardiac troponin immunoassays include the limit of blank (LoB), limit of detection (LoD), functional sensitivity, the 99th percentile of a healthy reference population, along with the percentage of “ostensibly healthy” subjects displaying measurable values 50% in the general healthy population. The very recent commercialization of methods with further improved analytical sensitivity (i.e., “ultra-sensitive”…

medicine.medical_specialtyAcute coronary syndromeCardiac troponinClinical BiochemistryClinical Chemistry TestsReview030204 cardiovascular system & hematologyCulpritacute coronary syndromecardiac troponin; myocardial infarction; acute coronary syndrome; diagnostics03 medical and health sciences0302 clinical medicineTroponin TLimit of DetectionInternal medicinecardiac troponinmedicinediagnosticsHumansIn patient030212 general & internal medicineMyocardial infarctionUltra sensitiveacute coronary syndrome; cardiac troponin; diagnostics; myocardial infarctionbusiness.industryHealthy populationBiochemistry (medical)Troponin Imedicine.diseaseClinical Practicemyocardial infarctionCardiologybusinessAlgorithmsBiochemia Medica
researchProduct