Search results for "ERT"

showing 10 items of 21537 documents

General Theory: Topological Aspects

2009

In Chapter 1, we have analyzed the structure of pip-spaces from the algebraic point of view only, (i.e., the compatibility relation). Here we will discuss primarily the topological structure given by the partial inner product itself. The aim is to tighten the definitions so as to eliminate as many pathologies as possible. The picture that emerges is reassuringly simple: Only two types of pip-spaces seem sufficiently regular to have any practical use, namely lattices of Hilbert spaces (LHS) or Banach spaces (LBS), that we have introduced briefly in the Introduction. Our standard reference on locally convex topological vector spaces (LCS) will be the textbook of Kothe [Kot69]. In addition, fo…

symbols.namesakeWeak topologyLocally convex topological vector spaceBanach spaceHilbert spacesymbolsStructure (category theory)TopologyStrong topology (polar topology)Mackey topologyMathematicsDual pair
researchProduct

Multiparametric Rational Solutions of Order N to the KPI Equation and the Explicit Case of Order 3

2021

We present multiparametric rational solutions to the Kadomtsev-Petviashvili equation (KPI). These solutions of order N depend on 2N − 2 real parameters. Explicit expressions of the solutions at order 3 are given. They can be expressed as a quotient of a polynomial of degree 2N(N +1)−2 in x, y and t by a polynomial of degree 2N(N +1) in x, y and t, depending on 2N − 2 real parameters. We study the patterns of their modulus in the (x,y) plane for different values of time t and parameters.

symbols.namesakesymbolsOrder (group theory)Applied mathematicsRiemann–Hilbert problemGeneral MedicineKadomtsev–Petviashvili equationMathematicsArchives of Current Research International
researchProduct

Uncertainty analysis and symmetry restoration in nuclear self-consistent methods

2015

This thesis contains two articles, in the following denoted by I and II, and an introduction to them. In Chapter 1, I present the theoretical models of nuclear structure. In Chapter 2, I introduce the basic ideas about the density functional theory (DFT) and self-consistent mean-field (SCMF) calculations. In Chapter 3, I give the formulae for the uncertainty propagation, which is the error analysis method used in article I. As a proper tool to survey the predictive power of theoretical models, the error analysis now has become more and more widely used. By analyzing the propagation of uncertainties, one tries to find out the e ectiveness of the calculation with a given parameter set obtaine…

symmetriaydinrakenneenergiatiheysfunktionaalitnuclear density functional theorytiheysfunktionaaliteorianuclear structurepropagation of uncertaintyenergy-density-functionalssymmetry restorationmatemaattiset mallitydinfysiikkavirheanalyysi
researchProduct

Hadronic light-by-light contribution to $(g-2)_\mu$ from lattice QCD with SU(3) flavor symmetry

2020

We perform a lattice QCD calculation of the hadronic light-by-light contribution to $(g-2)_\mu$ at the SU(3) flavor-symmetric point $m_\pi=m_K\simeq 420\,$MeV. The representation used is based on coordinate-space perturbation theory, with all QED elements of the relevant Feynman diagrams implemented in continuum, infinite Euclidean space. As a consequence, the effect of using finite lattices to evaluate the QCD four-point function of the electromagnetic current is exponentially suppressed. Thanks to the SU(3)-flavor symmetry, only two topologies of diagrams contribute, the fully connected and the leading disconnected. We show the equivalence in the continuum limit of two methods of computin…

symmetry: flavorParticle physicstopologymagnetic momentPhysics and Astronomy (miscellaneous)Feynman graphHigh Energy Physics::LatticeLattice field theoryHadronExtrapolationhep-lat01 natural sciencesspace: Euclideansymbols.namesakePionHigh Energy Physics - LatticeLattice (order)quantum chromodynamics0103 physical sciencesquantum electrodynamicsFeynman diagramcontinuum limit010306 general physicsEngineering (miscellaneous)perturbation theorylatticeParticle Physics - PhenomenologyQuantum chromodynamicsPhysicsform factor: transitioncurrent: electromagneticfinite size: effect[PHYS.HLAT]Physics [physics]/High Energy Physics - Lattice [hep-lat]010308 nuclear & particles physicslattice field theoryphoton photon: scatteringhep-phParticle Physics - LatticeLattice QCDsuppressionHigh Energy Physics - Phenomenology[PHYS.HPHE]Physics [physics]/High Energy Physics - Phenomenology [hep-ph]symbolsflavor: SU(3)n-point function: 4
researchProduct

Poliolefiny a środowisko

2002

Przedstawiono znaczenie, rozwój metod otrzymywania, kierunki zastosowania i perspektywy rozwoju poliolefin (polietylenu i polipropylenu), materiałów dominujących w światowej produkcji i zużyciu tworzyw sztucznych. Scharakteryzowano oddziaływania tych polimerów na środowisko, kolejno w etapie ich wytwarzania, wykorzystywania i utylizacji odpadów poużytkowych. Scharakteryzowano także kierunki badań prowadzonych w Instytucie Chemii Uniwersytetu Opolskiego w zakresie syntezy, charakterystyki, a przede wszystkim temo- i fotooksydacyjnej degradacji oraz starzenia atmosferycznego poliolefin.

synthesisapplicationspoliolefinystarzenie atmosferycznesyntezawłaściwościzastosowaniepropertiesutilization of wastesweathering processpolyolefinsdegradacja poliolefinutylizacja odpadówpolyolefin degradationElastomery
researchProduct

Synthesis and Structure-Affinity Relationships of Spirocyclic Benzopyrans with Exocyclic Amino Moiety

2019

σ1 and/or σ2 receptors play a crucial role in pathological conditions such as pain, neurodegenerative disorders, and cancer. A set of spirocyclic cyclohexanes with diverse O-heterocycles and amino moieties (general structure III) was prepared and pharmacologically evaluated. In structure-activity relationships studies, the σ1 receptor affinity and σ1:σ2 selectivity were correlated with the stereochemistry, the kind and substitution pattern of the O-heterocycle, and the substituents at the exocyclic amino moiety. cis-configured 2-benzopyran cis-11b bearing a methoxy group and a tertiary cyclohexylmethylamino moiety showed the highest σ1 affinity ( Ki = 1.9 nM) of this series of compounds. In…

synthesisexocyclic amino moietyReceptors Opioid mudocking studieCrystallography X-RayLigands01 natural sciencesopioid receptorschemistry.chemical_compoundProtein structureDrug DiscoveryMoiety0303 health sciencesσ1 receptor ligandsstructure (σ1) affinity relationshipmolecular dynamicBenzyl groupMolecular MedicinesynthesiBenzopyransSelectivityHydrophobic and Hydrophilic Interactionsfree binding enthalpyStereochemistrychange of receptor profileMolecular Dynamics Simulation03 medical and health sciencesStructure-Activity Relationshipσ1 receptor ligands; spirocyclic compounds; benzopyrans; benzofurans; exocyclic amino moiety; synthesis; structure (σ1) affinity relationships; σ1 antagonistic activity; receptor selectivity; molecular dynamics; docking studies; free binding enthalpy; X-ray crystal structure; opioid receptors; MOR affinity; change of receptor profile; structure MOR affinity relationshipsstructure (σ1) affinity relationshipsStructure–activity relationshipHumansReceptors sigmaBenzopyransSpiro Compoundsspirocyclic compoundBinding siteMOR affinity030304 developmental biologybenzopyranbenzofuransσ1 receptor ligandBinding Sitesspirocyclic compoundsreceptor selectivitystructure MOR affinity relationshipsdocking studiesbenzofuranopioid receptorX-ray crystal structuremolecular dynamics0104 chemical sciencesProtein Structure Tertiary010404 medicinal & biomolecular chemistrychemistrySalt bridgeσ1 antagonistic activity
researchProduct

Violent Conflicts and the New Mediatization: The Impact of Social Media on the European Parliamentary Agenda Regarding the Syrian War

2018

As key institutions in Western democracies, parliaments have gained importance regarding foreign affairs issues in recent years. Their increasing role as moral tribunes and discussion forums on conflict prevention and resolution have led to the parliamentarization of international affairs. The examination of the parliamentary agenda and the actors who shape it constitutes a fundamental part of agenda-setting studies as applied to the media and political systems. Among these actors, mass media must be highlighted, taking into account the complex process of information gathering for members of Parliament, particularly in cases related to international violent conflicts. Moreover, in the speci…

syriasocial networksparliamentParliamentparliamentary agendaCommunicationmedia_common.quotation_subjectsocial mediaconflictlcsh:P87-96lcsh:Communication. Mass medialcsh:AdvertisingPolitical sciencePolitical economySocial medialcsh:HF5801-6182media_commonmediatization
researchProduct

Document de référence d’une entreprise française : types de procès de la partie environnementale

2012

Tässä tutkimuksessa tarkasteltiin erään yrityksen vuosikertomuksen tekstin rakennetta. Tutkimuksen teoreettisena pohjana toimi M. A. K Hallidayn kehittämä systeemi- eli systeemis-funktionaalinen kielioppi, jonka määrittelemät eri prosessityypit toimivat lähemmän tarkastelun kohteena. Tutkimuksessa selvitettiin, mitä prosessityyppejä tekstistä on löydettävissä ja kuinka usein nämä esiintyvät aineistossa. Saatuja tuloksia verrattiin erääseen aikaisemmin ilmestyneeseen samankaltaiseen tutkimukseen. Aineistona tutkimuksessa käytettiin tekstiotteita ranskalaisen Arkema-nimisen yrityksen vuoden 2010 vuosikertomuksesta, tarkemmin sen ympäristöä käsittelevästä osiosta.

systeemis-funktionaalinen kielioppitoimintakertomukset
researchProduct

Contributions of mean and shape of blood pressure distribution to worldwide trends and variations in raised blood pressure: A pooled analysis of 1018…

2018

Background: Change in the prevalence of raised blood pressure could be due to both shifts in the entire distribution of blood pressure (representing the combined effects of public health interventions and secular trends) and changes in its high-blood-pressure tail (representing successful clinical interventions to control blood pressure in the hypertensive population). Our aim was to quantify the contributions of these two phenomena to the worldwide trends in the prevalence of raised blood pressure. Methods: We pooled 1018 population-based studies with blood pressure measurements on 88.6 million participants from 1985 to 2016. We first calculated mean systolic blood pressure (SBP), mean dia…

systolic blood pressureSettore MED/09 - Medicina Internablood pressure measurementHEALTH EXAMINATION SURVEYSBlood Pressure ; Hypertension ; Population Health ; Global Health ; Non-communicable DiseaseEpidemiology[SDV]Life Sciences [q-bio]global healthSouth Asia//purl.org/pe-repo/ocde/ford#3.03.09 [https]kohonnut verenpaineMedicine and Health Sciencesmiddle income countrymeasurement methodskin and connective tissue diseasesVDP::Medisinske Fag: 700::Klinisk medisinske fag: 750::Kardiologi: 771Public Environmental & Occupational HealthadultPopulation healthpublic healthblood pressure regulationPublic Health Global Health Social Medicine and EpidemiologyNon-communicable diseasekansainvälinen vertailuhealth surveyagedfemalepriority journalHypertensionBlood pressuremean arterial pressureGLOBAL TRENDSSODIUM-INTAKELife Sciences & Biomedicinesurvey designhypertensionprevalenceGlobal healthUNITED-STATESURBAN COMMUNITIESArticleSECULAR TRENDSMiddle EastCentral Asiamaledisease prevalence[SDV.MHEP.CSC]Life Sciences [q-bio]/Human health and pathology/Cardiology and cardiovascular systemkansanterveysbloodSYSTEMATIC ANALYSIShumanverenpainetautiBlood pressure; Global health; Hypertension; Non-communicable disease; Population health; Epidemiology; public health;non-communicable diseaseScience & TechnologyPacific Oceanhigh income countrydiastolic blood pressurePacific RimBlood pressure; Global health; Hypertension; Non-communicable disease; Population healthBlood Pressure - Epidemiology - PopulationNorth Africamajor clinical studyHYPERTENSION PREVALENCEverenpaineFolkhälsovetenskap global hälsa socialmedicin och epidemiologiARTERIAL-HYPERTENSION[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologiePOTASSIUM INTAKEsense organstrend analysistrend studypopulation researchpopulation health[SDV.MHEP]Life Sciences [q-bio]/Human health and pathologylow income country
researchProduct

Sädehoidon annossuunnitelmien säteilybiologinen vertailu

2008

sädehoitovertailusäteilysäteilybiologia
researchProduct