Search results for "confinement."

showing 10 items of 183 documents

Modelling steel jacketed RC columns: Remarks by experimental-numerical comparisons

2015

The recent large use of nonlinear seismic assessment techniques requires the definition of highly reliable computational models. The retrofitting or strengthening of RC columns by steel angles and battens is a commonly adopted technique, used to improve strength and deformation capacity of existing RC buildings. In the case of steel angles not directly loaded, the numerical definition of the cross-section model has to be handled carefully since it is affected by more uncertainties. The vertical load carried by the angles is a function of the lateral confinement pressure, the cohesion and the friction coefficient between the materials, parameters which are not always easy to predict. The pap…

Settore ICAR/09 - Tecnica Delle CostruzionicohesionconfinementOpenseesfrictionnumerical modellingOpensees confinement cohesion friction numerical modelling steel anglesCohesion friction numerical modelling steel angles opensees confinementsteel angles
researchProduct

PBO textile embedded in FRCM for confinement of r.c. columns

2014

Results of experimental tests on two reinforced concrete columns confined with PBO-FRCM jacketing subject to axial load and bending moments are presented, showing the effectiveness of the confinement system. Comparison of test results against theoretical results derived by a fiber model stress the ability of the confinement system to enhance both strength and deformation capacity of the confined concrete

Settore ICAR/09 - Tecnica Delle Costruzionir.c. confinement flexural ductility FRCM PBO fiber.
researchProduct

Quantum confinement effects observed by the photoluminescence of SiOx/SiO2 multilayers

2012

Spectral and decay features related to the red emission from Si nanocrystals were investigated by time-resolved photoluminescence spectra carried out on SiOx/SiO2 nanosized multilayers. On decreasing the SiOx thickness from 8.4 nm to 2.2 nm this luminescence band exhibits a blue-shift from 1.65 eV to 1.75 eV and its lifetime increases from 12μs to 17 μs. These results are discussed on the basis of previous models proposed in literature and agree with quantum confinement effects arising from differently sized Si nanocrystals in our samples.

SiOx/SiO2 mulilayers Si nanocrystal quantum confinement time-resolved photoluminescence
researchProduct

Experimental investigation on BFRCM confinement of masonry cylinders and comparison with BFRP system

2021

Abstract Fabric reinforced cementitious mortar (FRCM) materials have started to be employed during the last years with the aim of overcoming the drawbacks related to the use of fibre reinforced polymer (FRP) composites, proving to be potentially suitable for strengthening masonry structures. Moreover, the will to develop materials able to guarantee a certain degree of sustainability without renouncing to adequate mechanical properties has drawn the attention to the use of basalt fibres, which appear to be a valid alternative to carbon or glass fibres. This work presents an experimental investigation on a basalt FRCM (BFRCM) system to confine circular masonry columns, aimed at evaluating the…

Strengthening and repairDigital image correlationTextileMaterials scienceDigital image correlation (DIC)0211 other engineering and technologiesUniaxial compression020101 civil engineering02 engineering and technology0201 civil engineering021105 building & constructionBasalt FRCM Confinement Digital image correlation (DIC) Masonry cylinders Strengthening and repairGeneral Materials ScienceMasonry cylindersBasalt FRCMCivil and Structural Engineeringbusiness.industryBuilding and ConstructionStructural engineeringFibre-reinforced plasticMasonrySettore ICAR/09 - Tecnica Delle CostruzioniClay brickCementitiousMortarbusinessConfinement
researchProduct

Strength and strain enhancements of concrete columns confined with FRP sheets

2004

The compressive behavior up to failure of short concrete members reinforced with fiber reinforced plastic (FRP) is investigated. Rectangular cross-sections are analysed by means of a simplified elastic model, able also to explain stress-concentration. The model allows one to evaluate the equivalent uniform confining pressure in ultimate conditions referred to the effective confined cross-section and to the effective stresses in FRP along the sides of section; consequently, it makes it possible to determine ultimate strain and the related bearing capacity of the confined member corresponding to FRP failure. The effect of local reinforcements constitute by single strips applied at corners bef…

Stress-concentrationMaterials scienceStrain (chemistry)business.industryMechanical EngineeringMaximum compressive strengthRectangular cross-sectionBuilding and ConstructionSTRIPSStructural engineeringFibre-reinforced plasticOverburden pressurelaw.inventionSettore ICAR/09 - Tecnica Delle CostruzioniMechanics of MaterialslawBearing capacityUltimate strainComposite materialReinforcementbusinessConfinementFRPCivil and Structural EngineeringStress concentrationStructural Engineering and Mechanics
researchProduct

Printing Life-Inspired Subcellular Scale Compartments with Autonomous Molecularly Crowded Confinement.

2019

A simple, rapid, and highly controlled platform to prepare life-inspired subcellular scale compartments by inkjet printing has been developed. These compartments consist of fL-scale aqueous droplets (few µm in diameter) incorporating biologically relevant molecular entities with programmed composition and concentration. These droplets are ink-jetted in nL mineral oil drop arrays allowing for lab-on-chip studies by fluorescence microscopy and fluorescence life time imaging. Once formed, fL-droplets are stable for several hours, thus giving the possibility of readily analyze molecular reactions and their kinetics and to verify molecular behavior and intermolecular interactions. Here, this pla…

Surface PropertiesDNA hairpinBiomedical EngineeringGeneral Biochemistry Genetics and Molecular BiologyFluorescenceBiomaterialsSettore CHIM/01molecular crowdingbiomolecular confinementlife-like compartmentFluorescence microscopeInkjet printinginkjet printingBiochemistry Genetics and Molecular Biology (all)ChemistryDrop (liquid)Intermolecular forceLife timeDNABiomaterialFluorescencebiomolecular confinement; DNA hairpins; inkjet printing; life-like compartments; molecular crowdingDNA hairpinslife-like compartmentsPrinting Three-DimensionalBiophysicsMolecular probeAdvanced biosystems
researchProduct

Overview of first Wendelstein 7-X high-performance operation

2019

Abstract The optimized superconducting stellarator device Wendelstein 7-X (with major radius , minor radius , and plasma volume) restarted operation after the assembly of a graphite heat shield and 10 inertially cooled island divertor modules. This paper reports on the results from the first high-performance plasma operation. Glow discharge conditioning and ECRH conditioning discharges in helium turned out to be important for density and edge radiation control. Plasma densities of with central electron temperatures were routinely achieved with hydrogen gas fueling, frequently terminated by a radiative collapse. In a first stage, plasma densities up to were reached with hydrogen pellet injec…

TechnologyCONFINEMENT01 natural sciencesimpurities010305 fluids & plasmaslaw.inventionECR heatingDivertorDENSITY LIMITlawData_FILESGeneralLiterature_REFERENCE(e.g.dictionariesencyclopediasglossaries)004 Datenverarbeitung; InformatikPhysicsGlow dischargeDivertorCondensed Matter PhysicsContent (measure theory)ComputingMethodologies_DOCUMENTANDTEXTPROCESSINGElectron temperatureAtomic physicsddc:620StellaratorImpuritiesNuclear and High Energy PhysicsTechnology and Engineeringplasma performancechemistry.chemical_elementAtmospheric-pressure plasmaPHYSICSstellaratorPhysics::Plasma PhysicsNBI heating0103 physical sciencesdivertor010306 general physicsHeliumStellaratorPlasma performanceturbulenceFísicaW7-XTurbulenceTheoryofComputation_MATHEMATICALLOGICANDFORMALLANGUAGESchemistryddc:004ddc:600Energy (signal processing)SYSTEMNuclear Fusion
researchProduct

Sea bass Dicentrarchus labrax (L.) bacterial infection and confinement stress acts on F-type lectin (DlFBL) serum modulation

2014

The F-lectin, a fucose-binding protein found from invertebrates to ectothermic vertebrates, is the last lectin family to be discovered. Here, we describe effects of two different types of stressors, bacterial infection and confinement stress, on the modulation of European sea bass Dicentrarchus labrax (L.) F-lectin (DlFBL), a well-characterized serum opsonin, using a specific antibody. The infection of the Vibrio alginolyticus bacterial strain increased the total haemagglutinating activity during the 16-day testing period. The DlFBL value showed an upward regulation on the first, second and last days and underwent a slight downward regulation 4 days post-challenge. In contrast, the effect o…

Vibrio alginolyticusbiologyVeterinary (miscellaneous)Period (gene)LectinInflammationAquatic Sciencebiology.organism_classificationMicrobiologyAgglutination (biology)Fish DiseasesStress PhysiologicalLectinsImmunologymedicinebiology.proteinAnimalsDicentrarchusBassSea bassmedicine.symptomOpsoninconfinement stress Dicentrarchus labrax F-type lectin infection modulation teleost.
researchProduct

Physicochemical Investigation of the Solubilization of Ytterbium Nitrate in AOT Reverse Micelles and Liquid Crystals

2006

A wide investigation of the solubilization of the water-soluble salt Yb(NO3)(3) in sodium bis(2-ethylhexyl)sulfosuccinate (AOT) reverse micelles and AOT liquid crystals has been carried out. After saturation of water/AOT/organic solvent w/o microemulsions with pure Yb(NO3)(3), the Yb(NO3)(3)/AOT composites were prepared by complete evaporation under vacuum of the volatile components (water and organic solvent) of the salt-containing microemulsions. It was observed that these composites can be totally dissolved in pure n-heptane or CCl4, allowing the solubilization of a noticeable amount of Yb(NO3)(3) in quite dry apolar media. By UV-vis-NIR, FT-IR, and H-1 NMR spectroscopies, some informati…

YtterbiumPolymers and PlasticsSmall-angle X-ray scatteringytterbium nitrateAOT reverse micelleInorganic chemistryAnalytical chemistrychemistry.chemical_elementMicelleColloid and Surface ChemistrychemistryPulmonary surfactantLiquid crystalMaterials ChemistryProton NMRionic clustersconfinement effectMicroemulsionPhysical and Theoretical ChemistrySaturation (chemistry)solubilization
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct