Search results for "funktion"

showing 10 items of 213 documents

”Sivuttain mitattuna hänen elämänsä on hirvittävän pitkä.” : Kalle Päätalon representaatio Iijoki-sarjan kirja-arvosteluissa

2018

Kalle Päätalo on eräs kaikkien aikojen luetuimmista suomalaisista kirjailijoista, jonka kirjoja on painettu yli 3,5 miljoonaa kappaletta. Tutkielmani tarkoituksena on selvittää, millä tavalla Päätaloa representoidaan kirja-arvosteluissa ja minkälaisia diskursseja arvosteluissa esiintyy. Tutkimukseni teoreettisena viitekehyksenä toi-mivat systeemis-funktionaalinen kieliteoria (SF) ja kriittinen diskurssintutkimus. Tutkimuskysymyksiini vastaan hyödyntämällä representaation ja diskurssin käsitteitä. Diskurssit liittyvät erilaisiin vakiintuneisiin puhetapoihin ja representaatio tarkoittaa kirjaimellisesti ’asioiden uudelleen esittämistä’. Päätaloa on tutkittu aiemmin lähinnä kieli-ideologisesta…

kriittinen diskurssintutkimusrepresentaatiotekstilajisysteemis-funktionaalinen kieliteoria
researchProduct

Developments in many-body theory of quantum transport and spectroscopy with non-equilibrium Green's functions and time-dependent density functional t…

2015

The problem of quantum dynamics in open systems has gained attention in recent decades and not the least due to the advances made in quantum transport in molecular systems. The main motivation behind quantum transport and molecular electronics is the futuristic goal to be able at some point to replace, or to complement, the silicon-based technology and to make the electronic devices faster. On a fundamental level, one has to deal with time-dependent processes where electron-electron or electron- phonon interactions are of great importance, and they can cause profound quantitative and qualitative changes on the physical and dynamical properties of electronic systems compared to the non-inter…

kvanttikuljetuselektronikorrelaationanoelektroniikkatiheysfunktionaaliteoriamonen kappaleen häiriöteoriaGreenin funktiokvanttikemiakvanttimekaniikkakvanttifysiikkamolekyylielektroniikkaelektronittiheysmatriisirenormalisaatioryhmädynamiikka
researchProduct

Fiction through metaphor : a case study of The God of small things

2003

käsitteettekstitsemantiikkakirjallisuudentutkimusmetaforafunktionalismiaatehistoriatutkimusGoatly Andrewformalismi
researchProduct

Quitting one sphere and entering another : the translation of systemic functional transitivity patterns in Pride and Prejudice

2017

Kaunokirjallisuuden suomentaminen on luovaa toimintaa, jossa kääntäjä tekee valintoja monin eri perustein. Irrottautuminen lähtötekstistä on usein välttämätöntä, jotta voidaan saavuttaa sujuva suomennos. Tässä tutkimuksessa pyrittiin selvittämään, missä määrin kaunokirjallisessa käännöksessä voidaan poiketa alkuperäistekstistä funktionaalisten kategorioiden tasolla. Tutkimuksen aineistona oli Jane Austenin teos Pride and prejudice sekä Kersti Juvan vuonna 2014 nimellä Ylpeys ja ennakkoluulo julkaistu suomennos samasta teoksesta. Tutkittavaksi valittiin kolme katkelmaa teoksesta. Katkelmat analysoitiin käyttäen Gideon Touryn deskriptiivisen käännösteorian metodia. Tarkastelun kohteena olivat…

kääntäminenfunktionaalinen kielitiedekirjallisuuden kieli
researchProduct

Untertitelung im Fernsehen und ihre Zuverlässigkeit : Korpusanalyse von deutschsprachigen sachbezogenen Fernsehprogrammen im Licht der funktionalen T…

2000

kääntäminenkäännösfunktioekvivalenssiasiaohjelmatfunktionaalinen käännösteoriatelevisio-ohjelmatteoriattekstitys
researchProduct

Prompt and delayed spectroscopy of 203At : Observation of a shears band and a 29/2+ isomeric state

2018

Using fusion-evaporation reactions, a gas-filled recoil separator, recoil-gating technique and recoil-isomer decay tagging technique we have extended the level scheme of 203 At ( N = 118 ) significantly. We have observed an isomeric [ τ = 14.1 ( 3 ) μ s ] state with a spin and parity of 29 / 2 + . The isomeric state is suggested to originate from the π ( h 9 / 2 ) ⊗ ∣ ∣ 202 Po ; 11 − ⟩ coupling, and it is depopulated through 286 keV E 2 and 366 keV E 3 transitions. In addition, we have observed a cascade of magnetic-dipole transitions which is suggested to be generated by the shears mechanism. peerReviewed

level densitiesnuclear spinelectromagnetic transitionsnuclear density functional theorytiheysfunktionaaliteoriaspektroskopialifetimeswidthsenergy levelsNuclear Experimentisomer decaysydinfysiikkanuclear parity
researchProduct

Computational Criteria for Hydrogen Evolution Activity on Ligand-Protected Au25-Based Nanoclusters

2023

The hydrogen evolution reaction (HER) is a critical reaction in addressing climate change; however, it requires catalysts to be generated on an industrial scale. Nanomaterials offer several advantages over conventional HER catalysts, including the possibility of atomic precision in tailoring the intrinsic activity. Ligand-protected metal clusters, such as the thiolate-protected MAu24(SR)18 (where M is Au, Cu, Pd), are of particular interest as not only are they electrocatalytically active toward HER, but the charge state and composition can be precisely tuned. Here, we present a comprehensive computational study examining how the charge state and dopants affect the catalytic activity of [MA…

ligand protected clusterelektrokatalyysinanorakenteetgold nanoclustertiheysfunktionaaliteoriaelectrocatalysisHERdopingdensity functional theoryredox potential
researchProduct

Bildspråket i Bo Carpelans romaner "Vandrande skugga" och "Benjamins bok"

1999

liknelsebildspråkbildkällastilCarpelan Bometaforfunktionform
researchProduct

Stability, electronic structure, and optical properties of protected gold-doped silver Ag29-xAux (x = 0-5) nanoclusters

2017

In this work, we used density functional theory (DFT) and linear response time-dependent DFT (LR-TDDFT) to investigate the stability, electronic structure, and optical properties of Au-doped [Ag29−xAux(BDT)12(TPP)4]3− nanoclusters (BDT: 1,3-benzenedithiol; TPP triphenylphosphine) with x = 0–5. The aim of this work is to shed light on the most favorable doped structures by comparing our results with previously published experimental data. The calculated relative energies, ranging between 0.8 and 10 meV per atom, indicate that several doped Ag29−xAux nanoclusters are likely to co-exist at room temperature. However, only the Au-doped [Ag29−xAux(BDT)12(TPP)4]3− nanoclusters that have direct bon…

linear response timedependent DFTtiheysfunktionaaliteoriaAu-doped nanoclustershopeamolekyylitvakavuuselectronic structureoptiset ominaisuudet
researchProduct

Machine Learning for Predicting Chemical Potentials of Multifunctional Organic Compounds in Atmospherically Relevant Solutions

2022

We have trained the Extreme Minimum Learning Machine (EMLM) machine learning model to predict chemical potentials of individual conformers of multifunctional organic compounds containing carbon, hydrogen, and oxygen. The model is able to predict chemical potentials of molecules that are in the size range of the training data with a root-mean-square error (RMSE) of 0.5 kcal/mol. There is also a linear correlation between calculated and predicted chemical potentials of molecules that are larger than those included in the training set. Finding the lowest chemical potential conformers is useful in condensed phase thermodynamic property calculations, in order to reduce the number of computationa…

lämpökemiatiheysfunktionaaliteoriapotentiaalienergialaskennallinen kemiaCarbonilmakemiaMachine LearningOxygenkoneoppiminentermodynamiikkaThermodynamicsGeneral Materials ScienceOrganic ChemicalsPhysical and Theoretical Chemistryorgaaniset yhdisteetHydrogenThe Journal of Physical Chemistry Letters
researchProduct