Search results for "iu"

showing 10 items of 38021 documents

2021

Atomic layer deposition (ALD) technology has unlocked new ways of manipulating the growth of inorganic materials. The fine control at the atomic level allowed by ALD technology creates the perfect conditions for the inclusion of new cationic or anionic elements of the already-known materials. Consequently, novel material characteristics may arise with new functions for applications. This is especially relevant for inorganic luminescent materials where slight changes in the vicinity of the luminescent centers may originate new emission properties. Here, we studied the luminescent properties of CaS:Eu by introducing europium with oxygen ions by ALD, resulting in a novel CaS:EuO thin film. We …

010302 applied physicsPhotoluminescenceMaterials sciencebusiness.industryDopingchemistry.chemical_elementPhosphor02 engineering and technology021001 nanoscience & nanotechnology7. Clean energy01 natural sciencesIonAtomic layer depositionchemistry13. Climate action0103 physical sciencesOptoelectronicsGeneral Materials ScienceThin film0210 nano-technologybusinessLuminescenceEuropiumMaterials
researchProduct

Accumulation of positrons from a LINAC based source

2020

International audience; The GBAR experiment aims to measure the gravitational acceleration of antihydrogen H̅. It will use H̅+ ions formed by the interaction of antiprotons with a dense positronium cloud, which will require about 1010 positrons to produce one H̅+. We present the first results on the positron accumulation, reaching 3.8±0.4×108 e+ collected in 560 s.

010302 applied physicsPhysicsMeasure (physics)General Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnologyGravitational acceleration01 natural sciencesLinear particle acceleratorPositroniumNuclear physicsPositronPositron plasma; Positron accumulation; Antimatter; Penning-Malmberg trap; Greaves-Surko trap; GBAR[PHYS.QPHY]Physics [physics]/Quantum Physics [quant-ph]AntiprotonAntimatter0103 physical sciences[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]Physics::Accelerator PhysicsPhysics::Atomic Physics0210 nano-technologyAntihydrogenComputingMilieux_MISCELLANEOUSActa Physica Polonica A
researchProduct

Simulation and optimization of the implantation of holmium atoms into metallic magnetic microcalorimeters for neutrino mass determination experiments

2017

Abstract Several novel experiments designed to investigate the electron neutrino mass in the sub-eV region are based on the calorimetric measurement of the 163Ho electron capture spectrum. For this the 163Ho source, with a required activity of the order of 1 to 100 Bq , needs to be enclosed in the detector, having a volume smaller than 10 − 3 mm 3 . Ion implantation is presently considered to be the most reliable method to enclose this source in the detector homogeneously distributed in a well defined volume. We have investigated the distribution of implanted holmium ions in different target materials and for different implantation energies by means of Monte Carlo simulations based on the S…

010302 applied physicsPhysicsNuclear and High Energy PhysicsElectron captureMonte Carlo methodDetectorchemistry.chemical_element01 natural sciencesIonIon implantationchemistry0103 physical sciencesAtomic physicsNeutrino010306 general physicsHolmiumInstrumentationElectron neutrinoNuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment
researchProduct

Hot-cavity studies for the Resonance Ionization Laser Ion Source

2016

International audience; The Resonance Ionization Laser Ion Source (RILIS) has emerged as an important technique in many Radioactive Ion Beam (RIB) facilities for its reliability, and ability to ionize target elements efficiently and element selectively. GISELE is an off-line RILIS test bench to study the implementation of an on-line laser ion source at the GANIL separator facility. The aim of this project is to determine the best technical solution which combines high selectivity and ionization efficiency with small ion beam emittance and stable long term operation. The ion source geometry was tested in several configurations in order to find a solution with optimal ionization efficiency an…

010302 applied physicsPhysicsNuclear and High Energy PhysicsIon beamTitanium sapphire laser[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]Ion gun7. Clean energy01 natural sciencesIon sourceAtmospheric-pressure laser ionizationHot cavityRadioactive Ion BeamWork function materialResonant Ionization Laser Ion SourceIon beam depositionIonization0103 physical sciencesPhysics::Accelerator PhysicsThermal emittanceAtomic physicsBeam emittance010306 general physicsInstrumentation
researchProduct

Radiation hardness studies of CdTe and for the SIXS particle detector on-board the BepiColombo spacecraft

2009

Abstract We report of the radiation hardness measurements that were performed in the developing work of a particle detector on-board ESA's forthcoming BepiColombo spacecraft. Two different high- Z semiconductor compounds, cadmium telluride (CdTe) and mercuric iodide (HgI 2 ), were irradiated with 22 MeV protons in four steps to attain the estimated total dose of 10 12 p / cm 2 for the mission time. The performance of the detectors was studied before and after every irradiation with radioactive 55 Fe source Mn K α 5.9 keV emission line. We studied the impact of the proton beam exposure on detector leakage current, energy resolution and charge collection efficiency (CCE). Also the reconstruct…

010302 applied physicsPhysicsNuclear and High Energy PhysicsProton010308 nuclear & particles physicsbusiness.industryDetector7. Clean energy01 natural sciencesCadmium telluride photovoltaicsParticle detectorSemiconductor detectorSemiconductor13. Climate action0103 physical sciencesOptoelectronicsIrradiationbusinessInstrumentationRadiation hardeningNuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment
researchProduct

Description of intermodulation generation of nonlinear responses beyond the validity of the power series expansion

2021

Weakly nonlinear responses are commonly described by a power series expansion. However, intermodulation distortion products that cannot be described by a power series have been observed in a variety of physical systems. As the power series description is only applicable within its radius of convergence, we choose an alternative approach based on Fourier coefficients to describe intermodulation levels beyond the convergence of the power series. The description over a wide power range allows us to make a decision about models and to determine previously inaccessible model parameters. We apply the approach to data obtained from the characterization of the nonlinear dielectric susceptibility of…

010302 applied physicsPhysicsPower seriesPhysics and Astronomy (miscellaneous)Linear polarizationMathematical analysisSaturable absorption02 engineering and technologyDielectric021001 nanoscience & nanotechnology01 natural sciencesNonlinear system0103 physical sciencesRadius of convergence0210 nano-technologyFourier seriesIntermodulationApplied Physics Letters
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Hydrogen plasma induced photoelectron emission from low work function cesium covered metal surfaces

2017

Experimental results of hydrogen plasma induced photoelectron emission from cesium covered metal surfaces under ion source relevant conditions are reported. The transient photoelectron current during the Cs deposition process is measured from Mo, Al, Cu, Ta, Y, Ni, and stainless steel (SAE 304) surfaces. The photoelectron emission is 2–3.5 times higher at optimal Cs layer thickness in comparison to the clean substrate material. Emission from the thick layer of Cs is found to be 60%–80% lower than the emission from clean substrates. peerReviewed

010302 applied physicsPhysicsta114HydrogenTantalumAnalytical chemistrytransitionchemistry.chemical_elementSubstrate (electronics)plasmasCondensed Matter Physics01 natural sciencesIon sourcework functions010305 fluids & plasmasion sourceschemistryAluminiumCaesium0103 physical sciencesWork functionLayer (electronics)photoemissionPhysics of Plasmas
researchProduct

Positron Annihilation Lifetime Spectroscopy Insight on Free Volume Conversion of Nanostructured MgAl2O4 Ceramics

2021

H.K. and A.I.P. are grateful for the support from the COST Action CA17126. H.K. was also supported by the Ministry of Education and Science of Ukraine (project for young researchers No. 0119U100435). In addition, I.K. and H.K. were also supported by the National Research Foundation of Ukraine via project 2020.02/0217, while the research of A.I.P. was funded by the Latvian research council via the Latvian National Research Program under the topic ?High-Energy Physics and Accelerator Technologies?, Agreement No: VPP-IZM-CERN-2020/1-0002. In addition, the research of A.I.P. has been supported by the Latvian-Ukrainian Grant LV-UA/2021/5. The Institute of Solid State Physics, University of Latvi…

010302 applied physicsPositron trappingGeneral Chemical EngineeringFree-volume defectsPositron annihilationpositron annihilationnanoporespositronium decay02 engineering and technologynanostructured ceramicsfree-volume defectsnanostructured ceramics; positron annihilation; positronium decay; positron trapping; free-volume defects; nanopores021001 nanoscience & nanotechnologyPositronium decay7. Clean energy01 natural sciencesNanoporesChemistry0103 physical sciences:NATURAL SCIENCES [Research Subject Categories]positron trappingGeneral Materials Science0210 nano-technologyNanostructured ceramicsQD1-999Nanomaterials
researchProduct

Formation of translucent nanostructured zirconia ceramics

2021

Abstract In this work the mechanisms that affect the optical transparency of nanostructured translucent ZrO2 ceramics are studied. The translucent ceramic samples were obtained from a low agglomeration nanosized powder at low pressure and low temperature sintering. Even low pressures cause structural changes and defect creation in the nanocrystals. Annealing was used to study the grain formation, structure and impact of defects. Significant changes in translucency were observed with increase in pore size. In order to further understand the defect creation, the obtained ceramics were doped with Er3+ ions and studied optically. Photoluminescence studies revealed a change in the ratio of green…

010302 applied physicsQuenchingMaterials sciencePhotoluminescenceScanning electron microscopeAnnealing (metallurgy)Sintering02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesChemical engineeringTransmission electron microscopyvisual_art0103 physical sciencesMaterials ChemistryCeramics and Compositesvisual_art.visual_art_mediumCubic zirconiasense organsCeramic0210 nano-technologyJournal of the European Ceramic Society
researchProduct