Search results for "lex"

showing 10 items of 9741 documents

Kritische Anmerkungen zur H/B-Dreiteilung Vorgangspassiv - Zustandspassiv - allgemeine Zustandsform

2004

sein-reflexivetilarefleksiivipassivpassiivisyntaksisyntaxpassiivirestriktiotpassiv restrictions
researchProduct

New hydroxyapatite- and selenium-based nanoformulations as potential antimicrobial tools for orthopedic implants

selenium nanoparticles hydroxyapatite inorganic-inorganic complexesSettore CHIM/02 - Chimica Fisica
researchProduct

Entrapment of a linear water pentamer into a uranyl-salophen dimer in the solid state

2019

In the solid state, uranyl-salophen complex 1, decorated with bipyridyl sidearms, self-assembles from moist acetonitrile into dimeric species displaying a confined water pentamer, as observed by X-...

self-assembly; single crystal X-ray diffraction; uranyl-salophen complexes; Water clusters010405 organic chemistryPentamerDimerSolid-stateGeneral Chemistryself-assembly010402 general chemistry01 natural sciences0104 chemical sciencesEntrapmentchemistry.chemical_compoundWater clusterschemistryUranyl salophenPolymer chemistrySelf-assemblyuranyl-salophen complexesConfined waterAcetonitrilesingle crystal X-ray diffraction
researchProduct

The Translation of Sex-Related Language: The Danger(s) of Self-Censorship(s)1

2009

While censorship is an external constraint on what we can publish or (re)write, self-censorship is an individual ethical struggle between self and context. In all historical circumstances, translators tend to produce rewritings which are ‘acceptable’ from both social and personal perspectives. The translation of swearwords and sex-related language is a case in point, which very often depends on historical and political circumstances, and is also an area of personal struggle, of ethical/moral dissent, of religious/ideological controversies. In this paper we analyse the translation of the lexeme fuck into Spanish and Catalan. We have chosen two novels by Helen Fielding—Bridget Jones’s Diary (…

self-censorshipcensureLinguistics and LanguagetraductionLexemeSocial Sciences and Humanitiesmedia_common.quotation_subjectCompromisetranslationLanguage and Linguisticslangage sexuelauto-censure« fuck »media_commonLiteratureSelf-censorshipPolitenessbusiness.industryCensorshipsex-related languageAesthetics“fuck”Sciences Humaines et SocialescensorshipDissentIdeologyPsychologybusinessFuck
researchProduct

Why know myself? Flexible behaviour and the need for self-modelling: Poster

2021

In this paper I argue that some forms of the capacity for behavioural flexibility entail a specific kind of representation, a self-model. This means that systems with that capacity, among them human beings, must have self-models. In its basic form, the capacity for behavioural flexibility allows a system to respond to the same sensory stimulus differentially, depending on the values of parameters with which it represents the world. On seeing a street, I might cycle straight ahead or take a sharp turn left – depending on whether I represent it to blocked off just around the corner. More advanced forms expand on this. Self-models are a form of self-representation in which states are represent…

self-modelsrepresentationmapsself-representationflexible behaviour
researchProduct

Why know myself? Flexible behaviour and the need for self-modelling: Oral presentation

2021

self-modelsrepresentationmapsself-representationflexible behaviour
researchProduct

Aerosol properties, source identification, and cloud processing in orographic clouds measured by single particle mass spectrometry on a Central Europ…

2015

Abstract. Cloud residues and out-of-cloud aerosol particles with diameters between 150 and 900 nm have been analysed by on-line single particle aerosol mass spectrometry during the six-week study HCCT-2010 in September/October 2010. The measurement location was the mountain Schmücke (937 m a.s.l.) in Central Germany. More than 170 000 bipolar mass spectra from out-of-cloud aerosol particles and more than 14 000 bipolar mass spectra from cloud residual particles were obtained and were classified using a fuzzy c-means clustering algorithm. Analysis of the uncertainty of the sorting algorithm was conducted on a subset of the data by comparing the clustering output with particle-by-particle ins…

sense organscomplex mixtures
researchProduct

Towards Equivalence Links between Senses in PlWordNet and Princeton WordNet

2017

AbstractThe paper focuses on the issue of creating equivalence links in the domain of bilingual computational lexicography. The existing interlingual links between plWordNet and Princeton WordNet synsets (sets of synonymous lexical units – lemma and sense pairs) are re-analysed from the perspective of equivalence types as defined in traditional lexicography and translation. Special attention is paid to cognitive and translational equivalents. A proposal of mapping lexical units is presented. Three types of links are defined: super-strong equivalence, strong equivalence and weak implied equivalence. The strong equivalences have a common set of formal, semantic and usage features, with some o…

sense-levelLinguistics and LanguageComputer scienceequivalenceWordNetcomputer.software_genreEquivalenceLanguage and LinguisticsLexical itemsynsetinterlingual mappinglexical unitEquivalence (formal languages)060201 languages & linguisticsWordnetswordnetsbusiness.industryCommunication05 social sciences050301 education06 humanities and the arts0602 languages and literatureArtificial intelligencebusiness0503 educationcomputerNatural language processing
researchProduct

Multi-word Lexical Units Recognition in WordNet

2022

WordNet is a state-of-the-art lexical resource used in many tasks in Natural Language Processing, also in multi-word expression (MWE) recognition. However, not all MWEs recorded in WordNet could be indisputably called lexicalised. Some of them are semantically compositional and show no signs of idiosyncrasy. This state of affairs affects all evaluation measures that use the list of all WordNet MWEs as a gold standard. We propose a method of distinguishing between lexicalised and non-lexicalised word combinations in WordNet, taking into account lexicality features, such as semantic compositionality, MWE length and translational criterion. Both a rule-based approach and a ridge logistic regre…

sentence embeddingslexicographylexicalitysemantic compositionalitymulti-word expressionsPrinceton WordNet
researchProduct

Functional Information, Biomolecular Messages and Complexity of BioSequences and Structures

2010

In the quest for a mathematical measure able to capture and shed light on the dual notions of information and complexity in biosequences, Hazen et al. have introduced the notion of Functional Information (FI for short). It is also the result of earlier considerations and findings by Szostak and Carothers et al. Based on the experiments by Charoters et al., regarding FI in RNA binding activities, we decided to study the relation existing between FI and classic measures of complexity applied on protein-DNA interactions on a genome-wide scale. Using classic complexity measures, i.e, Shannon entropy and Kolmogorov Complexity as both estimated by data compression, we found that FI applied to pro…

sequence complexityFunctional Activity Sequence Complexity Combinatorics onWords Protein-DNA interaction.combinatorics on wordsFunctional activityprotein-DNA interaction.
researchProduct