0000000000098826

AUTHOR

Tuija Tammelin

showing 95 related works from this author

Results From Finland's 2016 Report Card on Physical Activity for Children and Youth.

2016

Background:Finland’s 2016 Report Card on Physical Activity for Children and Youth gathers and translates research results and assesses the status and promotion of physical activity (PA) among Finnish children and youth less than 18 years of age. This article summarizes the results and provides grades for 9 indicators.Methods:The working group evaluated the evidence and assigned grades of A (highest, 81% to 100%), B, C, D, or F (lowest, 0% to 20%) for 9 PA indicators using the Active Healthy Kids Canada Report Card development process.Results:The grades varied in Finland as follows: 1) Overall PA/fulfillment of recommendations = D, 2) Organized Sport Participation = C, 3) Active Play = C, 4)…

GerontologyPediatricsmedicine.medical_specialtyAdolescentmedia_common.quotation_subjectPhysical activityAdolescent Healthphysical activityHealth Promotion03 medical and health sciences0302 clinical medicinePromotion (rank)medicineHealth Status IndicatorsHumansOrthopedics and Sports Medicine030212 general & internal medicineadolescentsChildExerciseBuilt environmentActive playFinlandmedia_commonGovernmentHealth PolicyChild Health030229 sport sciencesSedentary BehaviorPsychologyReport cardpolicyJournal of physical activityhealth
researchProduct

The Associations of Objectively Measured Physical Activity and Sedentary Time with Cognitive Functions in School-Aged Children

2014

Abstract. Low levels of physical activity among children have raised concerns over the effects of a physically inactive lifestyle, not only on physical health but also on cognitive prerequisites of learning. This study examined how objectively measured and self- reported physical activity and sedentary behavior are associated with cognitive functions in school-aged children. The study population consisted of 224 children from five schools in the Jyva ̈ skyla ̈ school district in Finland (mean age 12.2 years; 56% girls), who participated in the study in the spring of 2011. Physical activity and sedentary time were measured objectively for seven consecutive days using the ActiGraph GT1M/GT3X …

Malecognitive functionsSocial Sciencesphysical activitylcsh:MedicinePediatricsExecutive FunctionCognitionChild DevelopmentAccelerometryMedicine and Health SciencesPsychologyPublic and Occupational HealthChildlcsh:ScienceProblem Solvingta515MultidisciplinaryCambridge Neuropsychological Test Automated BatteryChild HealthCognitionExecutive functionsFemaleBehavioral and Social Aspects of HealthPsychologyResearch ArticleClinical psychologymedicine.medical_specialtyAdolescentsedentary timeMotor ActivityScreen timeVisual memoryMemoryNeuropsychologymedicineLearningHumansSports and Exercise MedicineVideo gameSedentary lifestyleWorking memorylcsh:RCognitive PsychologyBiology and Life SciencesDevelopmental PsychologyPhysical therapyCognitive Sciencelcsh:QSedentary BehaviorNeurosciencePLoS ONE
researchProduct

Long-term determinants of changes in television viewing time in adults: Prospective analyses from the Young Finns Study

2018

Purpose The long-term effects of sociodemographic and health characteristics on television viewing (TV) time changes have not been identified in adulthood. We aimed to examine the modifiable and non-modifiable determinants of changes in TV-time in young adults over 10 years. Methods Participants (N = 2929) aged 24-39 years were recruited between 2001 and 2011 from the Cardiovascular Risk in Young Finns Study. Data were collected using questionnaires and a medical examination. The determinants of changes in TV-time were estimated using latent growth modeling for men and women separately. Results For men, inverse associations with initial levels of TV-time were observed for students becoming …

MaleHealth BehaviorPsychological interventionOverweight0302 clinical medicineajankäyttöSurveys and QuestionnairesOrthopedics and Sports Medicine030212 general & internal medicineProspective StudiesYoung adultkatselutottumuksetFinlandFamily CharacteristicsSmokingAge Factorsdeterminantsta3142aikuisuusFemaleTelevisionmedicine.symptomHealth habitsAdultEmploymentTelevision viewingTV-timeadulthoodlongitudinalPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusTime03 medical and health sciencesYoung Adultlatent growth modelingmedicineHumansObesityExercisebusiness.industryLatent growth modelingtelevisio (joukkoviestimet)030229 sport sciencesOverweightta3121medicine.diseasetaustatekijätObesityTime changesSedentary BehaviorbusinessDemographyFollow-Up StudiesScandinavian Journal of Medicine and Science in Sports
researchProduct

Associations of Leisure-Time Physical Activity Trajectories with Fruit and Vegetable Consumption from Childhood to Adulthood: The Cardiovascular Risk…

2019

A physically active lifestyle and a diet rich in vegetables and fruits have a central role in promoting health. This study examined the associations between leisure-time physical activity (LTPA) trajectories and fruit and vegetable consumption (FVC) from childhood to middle age. The data were drawn from the Cardiovascular Risk in Young Finns Study with six age cohorts. Participants were 9 to 18 years (n = 3536

MaleHealth Toxicology and MutagenesisLeisure timephysical activityliikuntaruokavaliotCardiovascular SystemVARIABLES0302 clinical medicineRisk FactorsVegetablesMedicine030212 general & internal medicineChildkohorttitutkimusDIETARY-CHANGESFinland18 COUNTRIESvihanneksetAge cohortsNaisten- ja lastentaudit - Gynaecology and paediatricsMiddle Aged3142 Public health care science environmental and occupational healthCardiovascular DiseasesOBESITYtrajectory1181 Ecology evolutionary biologyFOOD-FREQUENCY QUESTIONNAIREFemaleHEALTH BEHAVIOR-CHANGEfyysinen aktiivisuusAdultadulthoodAdolescentlongitudinalKansanterveystiede ympäristö ja työterveys - Public health care science environmental and occupational healthPhysical activity030209 endocrinology & metabolismpitkittäistutkimusMotor ActivityArticle03 medical and health sciencesFEV1/FVC ratioAGELeisure ActivitiesHumansVALIDITYExerciseLife Style1172 Environmental scienceschildhoodConsumption (economics)business.industryPublic Health Environmental and Occupational HealthMiddle ageDietFruitadolescenceGENDERSelf ReportSedentary BehaviorbusinessdietDemographyhedelmätInternational journal of environmental research and public health
researchProduct

Do childhood motor problems predict later academic achievement through physical activity, fitness and obesity?

2012

Physical activitymedicinePhysical Therapy Sports Therapy and RehabilitationOrthopedics and Sports MedicineAcademic achievementPsychologymedicine.diseaseObesityDevelopmental psychologyJournal of Science and Medicine in Sport
researchProduct

Physical inactivity from youth to adulthood and adult cardiometabolic risk profile

2020

Adults with a low physical activity (PA) level are at increased risk for cardiometabolic diseases, but little is known on the association between physical inactivity since youth and cardiometabolic health in adulthood. We investigated the association of persistent physical inactivity from youth to adulthood with adult cardiometabolic risk factors. Data were drawn from the ongoing Cardiovascular Risk in Young Finns Study with seven follow-ups between 1980 and 2011 (baseline age 3–18 years, n = 1961). Physical activity data from a standardized questionnaire was expressed as a PA-index. Using the PA-index, four groups were formed: 1)persistently physically inactive (n = 246), 2)decreasingly ac…

Adultmedicine.medical_specialtyelintavatWaistAdolescentlongitudinalEpidemiologymedicine.medical_treatmentinactive lifestylepitkittäistutkimusLower risk01 natural sciencesBody Mass Index03 medical and health scienceschemistry.chemical_compound0302 clinical medicineRisk FactorsInternal medicinemedicineHumans030212 general & internal medicine0101 mathematicsChildExerciseFinland2. Zero hungerTriglyceridebusiness.industryInsulincardiovascular010102 general mathematicsPublic Health Environmental and Occupational Healthlapsuusmedicine.diseasechildhood [CVD]ObesityBlood pressurechemistryCardiovascular DiseasesChild Preschoolsydän- ja verisuonitauditnuoruusMetabolic syndromeSedentary BehaviorWaist CircumferencebusinessBody mass indexterveysriskitfyysinen aktiivisuus
researchProduct

Estimation of aerobic fitness among young men without exercise test

2015

Summary Study aim: to develop and estimate the validity of non-exercise methods to predict VO2max among young male conscripts entering military service in order to divide them into the different physical training groups. Material and methods: fifty males (age 19.7 ± 0.3 years) reported their physical activity before military service by IPAQ and SIVAQ questionnaires. Furthermore, Jackson’s non-exercise method was used to estimate VO2max. Body mass and height were measured, body mass index calculated and VO2max measured directly in a maximal treadmill test. Subjects were randomly divided into two groups. The results of the Group 1 (N = 25) were used to develop a regression equation to estimat…

GerontologyGroup basedPhysiologyexercise testmenPhysical Therapy Sports Therapy and RehabilitationAltman plotregression analysisregressioanalyysiAerobic exerciseQP1-981Orthopedics and Sports MedicineTreadmillYoung malemilitaryMathematicsRegression analysisTest (assessment)sotaväkiaerobic capacitySports medicineaerobinen suorituskykymiehetBody mass indexhuman activitiesRC1200-1245DemographyBiomedical Human Kinetics
researchProduct

Suspected motor problems and low preference for active play in childhood are associated with physical inactivity and low fitness in adolescence.

2011

Background This prospective longitudinal study investigates whether suspected motor problems and low preference for active play in childhood are associated with physical inactivity and low cardiorespiratory fitness in adolescence. Methodology/Principal Findings The study sample consisted of the Northern Finland Birth Cohort 1986 (NFBC 1986) composed of 5,767 children whose parents responded to a postal inquiry concerning their children's motor skills at age 8 years and who themselves reported their physical activity at age 16 years. Cardiorespiratory fitness was measured with a cycle ergometer test at age 16 years. Odds ratios (OR) and their 95% confidence intervals (95% CI) for the level o…

Longitudinal studymedicine.medical_specialtyAdolescentPhysical fitnesslcsh:MedicineMotor ActivityChoice Behavior03 medical and health sciences0302 clinical medicinemedicineHumans030212 general & internal medicineLongitudinal StudiesProspective Studiesta315Prospective cohort studyChildlcsh:Scienceta515Motor skillFinland2. Zero hungerMultidisciplinarybusiness.industrylcsh:RPediatrics and Child Health/Adolescent MedicineCardiorespiratory fitness030229 sport sciencesOdds ratiomedicine.diseaseObesityPediatrics and Child Health/Child DevelopmentPhysical FitnessPhysical therapyPublic Health and Epidemiology/Preventive Medicinelcsh:QPublic Health and Epidemiology/Exercise and SportsbusinessBody mass indexPublic Health and Epidemiology/Social and Behavioral Determinants of HealthDemographyResearch ArticlePLoS ONE
researchProduct

Physical fitness development in relation to changes in body composition and physical activity in adolescence

2020

The decline in adolescents’ physical fitness (PF) in recent decades has raised concerns about current population’s possible future challenges with health and physical functional capacity. This study explored the associations between body composition, physical activity, maturation, and PF development in adolescents. Furthermore, PF development of adolescents with low initial PF was assessed. A 2‐year observational study was conducted between spring 2013 and 2015. Nine comprehensive schools and their 10‐ to 13‐year‐old students were invited to participate in the study (1778), and a total of 971 students (54.6%) agreed. Cardiorespiratory fitness (20‐metre shuttle run), muscular fitness (push‐u…

MalePediatric ObesityTime FactorsPhysical fitnessPsychological intervention030204 cardiovascular system & hematologyliikunta0302 clinical medicinenuoretElectric ImpedanceMedicineOrthopedics and Sports MedicineChildFinlandfundamental movement skillseducation.field_of_studycardiorespiratory fitnessfat massPhysical Functional Performancefat-free massfyysinen kuntomuscular fitnessCardiorespiratory Fitnessfyysinen kehitysBody CompositionFemaleBioelectrical impedance analysisfyysinen aktiivisuusMulti-stage fitness testAdolescentMovementPopulationPhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)03 medical and health scienceschildrenConfidence IntervalsHumansStudentseducationExercisekehonkoostumusbusiness.industryLatent growth modelingPubertyCardiorespiratory fitness030229 sport sciencesPhysical FitnessObservational studybusinessDemography
researchProduct

Validity and Reliability of a Single Question for Leisure-Time Physical Activity Assessment in Middle-Aged Women.

2020

Purpose: To investigate the validity and test–retest reliability of a single seven-level scale physical activity assessment question (SR-PA L7) and its three-level categorization (SR-PA C3). Methods: The associations of SR-PA L7 and C3 with accelerometer-measured leisure-time physical activity (ACC-LTPA) and with the results of four different physical performance tests (6-min walk [n = 733], knee extension [n = 695], vertical jump [n = 731], and grip force [n = 780]) were investigated among women aged 47–55 years participating in the Estrogenic Regulation of Muscle Apoptosis study (n = 795). The reliability was studied using Spearman correlations with 4-month test–retest period (n = 152). R…

Leisure timePhysical activityValidityPhysical Therapy Sports Therapy and RehabilitationWalkingtestaus03 medical and health sciencesVertical jump0302 clinical medicineLeisure Activitiesphysical activity measurementSurveys and QuestionnairesStatisticstest–retest reliabilityaccelerometryHumans030212 general & internal medicineself-reported physical activityReliability (statistics)MathematicsHand StrengthRehabilitationReproducibility of Results030229 sport sciencesRepeatabilityMiddle AgedPhysical FitnessScale (social sciences)Exercise TestFemaleGeriatrics and GerontologyGrip forceGerontologyhuman activitiesfyysinen aktiivisuusluotettavuusJournal of aging and physical activity
researchProduct

How physical activity, fitness, and motor skills contribute to math performance: Working memory as a mediating factor

2021

Purpose The purpose of this study was to examine whether physical activity, fitness and motor skills have indirect association with math performance via cognitive outcomes and if so, through which aspects of cognition? Methods This study comprised 311 6th–9th grade adolescents (12–17y [M age=14.0y], 59% girls) from seven schools throughout Finland in 2015. Math performance was measured via a teacher-rated math achievement and the Basic Arithmetic test. Cognitive functions were measured by broad cognitive test battery. Physical activity was assessed with a self-reported questionnaire and a hip-worn accelerometer. Aerobic fitness was estimated using a maximal 20-m shuttle run test, muscular f…

kognitiiviset taidotMaleAdolescenteducationPhysical fitnesslapset (ikäryhmät)Physical Therapy Sports Therapy and RehabilitationFitness Trackersliikuntabehavioral disciplines and activitiesworking memoryDevelopmental psychologyCognitionnuoretAcademic PerformanceAccelerometrymental disordersmatemaattiset taidotHumansOrthopedics and Sports MedicineadolescentsCognitive skillmotoriset taidotChildMuscle SkeletalAssociation (psychology)ExerciseFinlandMotor skillmotor skillsWorking memorybusiness.industryCognitiontyömuistiTest (assessment)Cognitive testfyysinen kuntoMemory Short-TermMotor SkillsPhysical Fitnessphysical fitnessExercise TestFemalebusinessfyysinen aktiivisuuspsychological phenomena and processesScandinavian Journal of Medicine & Science in Sports
researchProduct

Relationship between Fundamental Motor Skills and Physical Activity in 4-Year-Old Preschool Children

2013

This study evaluated the relationships between objectively measured physical activity and fundamental motor skills in 4-year-old children. Physical activity was monitored in 20 girls and 17 boys over 5 consecutive days (3 days at preschool and 2 days at home) and their fundamental motor skills measured. Multiple linear regressions controlled for sex, age, and body mass index indicated that the total skill score was significantly associated with physical activity, explaining 13%, 16%, and 16% of the variance in total, moderate-to-vigorous, and light-to-vigorous physical activity, respectively. Sliding and galloping were significantly associated with moderate-to-vigorous physical activity, a…

Malemedicine.medical_specialtyMultivariate analysisPhysical activityfood and beveragesExperimental and Cognitive PsychologyMotor ActivitySensory SystemsMotor SkillsChild PreschoolAccelerometryMultivariate AnalysisLinear ModelsPhysical therapymedicineHumansFemaleta315PsychologyBody mass indexThrowingMotor skillPerceptual and Motor Skills
researchProduct

Objectively Measured School Day Physical Activity Among Elementary Students in the United States and Finland.

2015

Background:Schools are in a unique position to ensure that all students meet the current physical activity (PA) recommendations. This study aimed to examine 1st to 3rd grade elementary students’ accelerometer measured school day PA in the United States (U.S.) and Finland.Methods:The sample consisted of 200 students (107 girls, 93 boys; ages 6 to 8) and their school day PA was monitored with hip-worn ActiGraph GT3X+ accelerometers across a 5-day school week and the thresholds 100 and 2296 count per minute were used to separate sedentary time, light PA, and moderate-to-vigorous PA (MVPA).Results:On an average school day, students were engaged in MVPA for 20.0 min in the U.S. and 24.1 min in F…

Cross-Cultural ComparisonMalemedicine.medical_specialtyTime FactorseducationPhysical activityChild BehaviorMotor ActivityPhysical education03 medical and health sciences0302 clinical medicineschool health promotionMedicineHumansOrthopedics and Sports Medicine030212 general & internal medicineMotor activitySex DistributionChildStudentsExercisePhysical ExaminationFinlandSedentary lifestyleaccelometrySedentary timePhysical Education and TrainingSchoolsbusiness.industry030229 sport sciencesschool healthUnited StatesPhysical therapyFemaleSchool healthSedentary BehaviorbusinessJournal of physical activityhealth
researchProduct

Differences in physical activity at recess and school-related social factors in four Finnish lower secondary schools

2017

This study investigated the differences in physical activity (PA) at recess and school-related social factors, and described school PA promotion processes and staff experiences at four lower secondary schools from the Finnish Schools on the Move programme. Recess PA, peer relationships at school, relatedness to school, and school climate were assessed via surveys with eighth-grade students in spring 2011 (n ¼ 385) and spring 2013 (n ¼ 373). Local contact people in the school projects (n ¼ 6), school staff (n ¼ 83) and principals (n ¼ 3) provided information on the PA promotion process via telephone interviews and surveys. Differences in student-level data in years 2011 and 2013 were analyse…

MaleAdolescentmedia_common.quotation_subjecteducationphysical activityOrganizational culturekouluyhteisöSocial EnvironmentPeer GroupEducation03 medical and health sciencesInterpersonal relationship0302 clinical medicinePromotion (rank)Sex FactorsSurveys and QuestionnairesEmployee engagementHumansta516lower secondary schoolsNarrativeInterpersonal Relations030212 general & internal medicineta315ChildStudentssocial factorsExerciseFinlandSocial influencemedia_commonMedical educationSchoolsrecessPublic Health Environmental and Occupational HealthSocial environmentPeer group030229 sport sciencesOriginal ArticlesvälitunnitOrganizational CultureFemaleyläkouluPsychologySocial psychologyfyysinen aktiivisuusHealth Education Research
researchProduct

Daily steps among Finnish adults: Variation by age, sex, and socioeconomic position

2011

Aims: The aim of this study was to provide descriptive population-based pedometer data from adults aged 30-45 years in Finland, and to compare daily step counts with evidence-based indices. Methods: The data was collected from 1853 participants in 7 consecutive days in winter 2007—08 in part of 27-year follow up of the Cardiovascular Risk in Young Finns study. Results: The participants took (mean±standard deviation) 7499 ± 2908 steps/day. Step counts included 1925 ± 2052 aerobic steps/day gathered in bouts of at least 10 min continuous ambulatory activity. Women had more total steps than men ((7824 ± 2925 vs. 7089 ± 2774; p < 0.001). Although participants had higher mean total steps on …

AdultMalemedicine.medical_specialtyInjury controlSocioeconomic positionNames of the days of the weekPopulationMonitoring AmbulatoryPoison controlHealth PromotionWalkingMotor ActivityInjury preventionHumansMedicineta315educationFinlandeducation.field_of_studybusiness.industryPublic Health Environmental and Occupational HealthGeneral MedicineMiddle AgedSocioeconomic FactorsPedometerAmbulatoryPhysical therapyFemalebusinessScandinavian Journal of Public Health
researchProduct

Education Leads to a More Physically Active Lifestyle : Evidence Based on Mendelian Randomization

2019

Physical inactivity is a major health risk worldwide. Observational studies suggest that higher education is positively related to physical activity, but it is not clear whether this relationship constitutes a causal effect. Using participants (N = 1651) drawn from the Cardiovascular Risk in Young Finns Study linked to nationwide administrative data from Statistics Finland, this study examined whether educational attainment, measured by years of education, is related to adulthood physical activity in terms of overall physical activity, weekly hours of intensive activity, total steps per day, and aerobic steps per day. We employed ordinary least squares (OLS) models and extended the analysis…

AdultMaleEvidence-based practiceHigher educationregister‐based dataväestötutkimusphysical activityPhysical Therapy Sports Therapy and Rehabilitation030204 cardiovascular system & hematologyliikuntaEducation03 medical and health sciences0302 clinical medicinekoulutustasoMendelian randomizationGlobal healthMendelian randomizationMedicineHumansOrthopedics and Sports MedicineLongitudinal Studies315 Sport and fitness sciencesExerciseLife StyleelämäntapaFinlandväestötietojärjestelmäteducationbusiness.industryInstrumental variable030229 sport sciencesMendelian Randomization AnalysisMiddle Aged3142 Public health care science environmental and occupational healthEducational attainmentCross-Sectional StudieskoulutusOrdinary least squaresObservational studyFemalebusinessfyysinen aktiivisuusDemography
researchProduct

Tracking of Television Viewing Time during Adulthood: The Young Finns Study.

2016

Purpose: The aim of this study was to investigate the tracking of television viewing (TV) time as an indicator of sedentary behavior among adults for a period of 25 yr. Methods: A random sample of 1601 subjects (740 men) age 18, 21, and 24 yr participated in the Cardiovascular Risk in Young Finns Study in 1986. TV time during leisure time was measured with a single self-report question at baseline and in 2001, 2007, and 2011. Tracking of TV time was analyzed using Spearman rank correlations and simplex models. Level and change of TV time were examined using linear growth modeling. Results: The 4- and 6-yr integrated TV time stability coefficients, adjusted for measurement errors, were Q0.60…

GerontologyAdultMaleTelevision viewingTV viewingTime FactorsAdolescentLeisure timePhysical Therapy Sports Therapy and RehabilitationSpearman's rank correlation coefficientadult population03 medical and health sciencesYoung Adult0302 clinical medicineSex Factorssedentary behaviorHumansOrthopedics and Sports Medicine030212 general & internal medicineLongitudinal StudiesYoung adultta315FinlandSedentary lifestylemonitasoanalyysiage cohortsAge Factorsta3141ta3142030229 sport sciencesSedentary behaviorstabilityMiddle Agedmultilevel analysisFemaleTelevisionTracking (education)Sedentary BehaviorLinear growthPsychologyDemographyMedicine and science in sports and exercise
researchProduct

Objectively measured physical activity, body composition and physical fitness: Cross-sectional associations in 9- to 15-year-old children.

2018

The aim of this study was to examine and quantify the cross-sectional associations of body composition (BC), physical activity (PA) and sedentary time (ST) with physical fitness (PF) in children and adolescents. A sample of 594 Finnish students (56% girls), aged 9-15 (12.4 ± 1.3 years) were selected for a study performed in 2013. The measurements of the Move! monitoring system for physical functional capacity were used to measure cardiorespiratory and musculoskeletal fitness and fundamental movement skills. Moderate-to-vigorous PA (MVPA) and ST were measured objectively with an accelerometer and BC by a bioelectrical impedance analysis. Fat mass index (FMI) and fat-free mass index (FFMI) we…

GerontologyMaleAdolescentCross-sectional studyPhysical fitnessPhysical activityphysical activityPhysical Therapy Sports Therapy and Rehabilitation03 medical and health sciences0302 clinical medicinenuoretchildrenAccelerometryMedicineHumansOrthopedics and Sports Medicineadolescents030212 general & internal medicineLongitudinal Studiesta315ChildExerciselapsetFinlandkehonkoostumusSedentary lifestyleSedentary timebusiness.industryta3142030229 sport sciencesGeneral Medicinefyysinen kuntoCross-Sectional StudiesPhysical FitnessBody CompositionFemaleSedentary Behaviorbusinessfyysinen aktiivisuusEuropean journal of sport science
researchProduct

Comparing the physical activity patterns of 3-year-old Finnish and Australian children during childcare and homecare days

2014

AbstractLimited previous research has contrasted physical activity (PA) patterns in preschool children across different hourly patterns or segments of day, or adopted similar methodologies to compare the PA behaviors of children from different countries. The purpose of this study was to examine how the PA levels and patterns differed between 3- year-olds within and between childcare and homecare days in Finland and Australia.ActiGraph GT3X accelerometers were used to monitor 121 (80 Finnish, 41 Australian) children’s PA for five consecutive days.No significant country differences were observed in children’s daily total PA (light-tovigorous PA [LMVPA]), except that during childcare days Finn…

lcsh:SportsPediatricsmedicine.medical_specialtypreschool childrenbusiness.industrymedia_common.quotation_subjectGeneral EngineeringPhysical activityAttendanceCountry differencesphysical activityaccelerometerlcsh:GV557-1198.995Promotion (rank)country comparisonmedicinebusinessmedia_commonDemographyBaltic Journal of Health and Physical Activity
researchProduct

Physical activity, aerobic fitness, and brain white matter : Their role for executive functions in adolescence

2020

Highlights • Aerobic fitness level, but not physical activity, is related to white matter properties in the brain. • The relation between physical activity and working memory is moderated by fractional anisotropy (FA) of the corpus callosum. • The FA of the corpus callosum and superior corona radiata moderates the relation between aerobic fitness and working memory.

Malephysical activitySpatial memoryDevelopmental psychologyExecutive functionsExecutive Function0302 clinical medicinenuoretCOGNITIVE CONTROLDWI diffusion-weighted imagingFitnessdiffuusiotensorikuvaus315 Sport and fitness sciencesPLASTICITYFA fractional anisotropyChildOriginal ResearchTBSS Tract-Based Spatial Statisticslcsh:QP351-495White matterCognitionExecutive functionsdiffusion tensor imagingexecutive functionsmurrosikäRD radial diffusivityINTEGRITYfitnessfyysinen kuntomedicine.anatomical_structureDiffusion tensor imagingFemalePsychologyaivotRVP rapid visual information processingwhite matterNeurovetenskaperAD axial diffusivityfractional anisotropyfyysinen aktiivisuusMulti-stage fitness testendocrine systemtoiminnanohjaus (psykologia)AdolescentDISTORTION CORRECTIONMVPA moderate-to-vigorous intensity physical activityPhysical activityTFCE threshold-free cluster enhancementWhite matter03 medical and health sciencesWORKING-MEMORY030225 pediatricsmedicineAerobic exerciseHumansExerciseAgedOBJECTIVE MEASURESMD mean diffusivityWorking memoryPhysical activityNeurosciencesPUBERTAL CHANGESvalkea aineCORPUS-CALLOSUMlcsh:Neurophysiology and neuropsychologySWM patial working memoryVOLUMEMICROSTRUCTURECANTAB Cambridge Neuropsychological Automated Test BatteryMRI magnetic resonance imaging030217 neurology & neurosurgeryFractional anisotropy
researchProduct

Seasonal and daily variation in physical activity among three-year-old Finnish preschool children

2013

The purposes of this study were to assess seasonal, daily, and gender variations in children’s physical activity (PA). ActiGraph GT3X accelerometers were used to record the three-year-old children’s PA levels for five consecutive days in autumn and winter. Complete data for both seasons were obtained for 47 children. Despite a significant difference in seasonal temperatures (p < .001), differences were only found for weekdays light PA (p = .021). No difference in PA was observed between weekdays and weekend days. Only 20% of the sample had ≥120 minutes light-to-vigorous PA (LMVPA), and 46% of children had ≥60 minutes moderate-to-vigorous PA (MVPA). Boys spent more minutes in LMVPA (p = .001…

Complete dataSocial PsychologyNames of the days of the weekSignificant differenceeducationPhysical activityphysical activitychildcareta3141päivähoitoPediatricsPhysical activity levelvarhaislapsuusaccelerometerDevelopmental and Educational PsychologyStatistical analysisPsychologyfyysinen aktiivisuusDemographykiityvyysmittariEarly Child Development and Care
researchProduct

Mindfulness skills, psychological flexibility, and psychological symptoms among physically less active and active adults

2014

Abstract Mindfulness skills, psychological flexibility and psychological symptoms were compared among 58 physically less active and 50 physically active adults who were recruited and classified based on their self-reported physical activity. Additionally, this study evaluated the association of objectively measured physical activity with psychological variables. Methods Participants completed questionnaires evaluating their mindfulness skills and psychological flexibility as well as their psychological and depressive symptoms. Physical activity was assessed objectively using an accelerometer for seven consecutive days. Results Based on the self-reported physical activity levels physically a…

Psychiatry and Mental healthMindfulnessWell-beingPhysical activityFlexibility (personality)PsychologyAssociation (psychology)Depressive symptomsApplied Psychologyta515Clinical psychologyMental Health and Physical Activity
researchProduct

Effects of school-based physical activity on mathematics performance in children: a systematic review

2019

AbstractBackgroundThe benefits of physical activity (PA) on children’s health and wellbeing are well established. However, the benefits of PA on academic performance and particularly on mathematics performance warrant systematic analysis. Mathematics is one of the core subjects in school education globally.MethodsWe systematically searched, analysed and synthesized the literature on the effects of school-based PA interventions on mathematics performance in children aged 4–16. A total of 29 studies consisting of randomised trials and other interventions with control groups were identified through a systematic search, and 11 of them provided sufficient data and appropriate design for a meta-a…

opintomenestysAdolescentPsychological interventionPhysical activityphysical activityMedicine (miscellaneous)Behavioural sciencesPhysical Therapy Sports Therapy and RehabilitationInterventionClinical nutritionReviewliikunta03 medical and health sciences0302 clinical medicineIntervention (counseling)matemaattiset taidotHumans030212 general & internal medicineChildlcsh:RC620-627mathematics performanceExerciseinterventioninterventioSchool educationSchool Health ServicesNutrition and DieteticsSchoolsPhysical activitylcsh:Public aspects of medicinelcsh:RA1-1270030229 sport sciencesMathematics performancelcsh:Nutritional diseases. Deficiency diseasesChild PreschoolSchool basedEducational Measurementfyysinen aktiivisuusMathematicsSystematic searchClinical psychologyThe International Journal of Behavioral Nutrition and Physical Activity
researchProduct

Does organized sport participation during youth predict healthy habits in adulthood? A 28-year longitudinal study

2018

Health behaviors in youth can predict the same behaviors later in life, but the role of sport participation in predicting healthy lifestyle habits is unclear. This study aimed to investigate the association between participation in organized youth sport and adult healthy lifestyle habits. Data from the longitudinal Cardiovascular Risk in Young Finns Study (YFS) with a 28-year follow-up were used. The participation in sport-club training sessions was self-reported by 9-18-year-olds in 1983 and 1986 (n = 1285). During 2011, participants (aged 37-43-year old) reported their smoking status, alcohol consumption, fruit and vegetable consumption, and physical activity. Odd ratios (OR) were calcula…

AdultMaleelintavatLongitudinal studylongitudinalAdolescentAlcohol DrinkingHealth BehaviorPhysical activityphysical activityPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusLogistic regressionOddsHabitsYoung Adult03 medical and health sciences0302 clinical medicineHumansOrthopedics and Sports MedicineHealthy LifestyleLongitudinal Studies030212 general & internal medicineliikuntaharrastusta315ChildFinlandConsumption (economics)youthSmokingYouth Sportsta3142030229 sport sciencesDiethealth behaviorsaikuisuusLogistic ModelsterveyskäyttäytyminennuoruusFemaleSmoking statusSelf ReportsportLifestyle habitsPsychologyAlcohol consumptionfyysinen aktiivisuusDemographyScandinavian Journal of Medicine &amp; Science in Sports
researchProduct

Childhood Physical Activity and Adulthood Earnings

2016

Purpose: This study examined the associations between childhood physical activity level and adulthood earnings. Methods: The data were drawn from the ongoing longitudinal Young Finns Study, which was combined with register-based Finnish Longitudinal Employer–Employee Data and registerbased parents_ background information from the Longitudinal Population Census of Statistics Finland. The study consisted of children who were 9 yr (n = 1257, 52% boys), 12 yr (n = 1662, 51% boys), and 15 yr (n = 1969, 49% boys) of age at the time when physical activity was measured. The children were followed until 2010, when they were between 33 and 45 yr old. Leisure-time physical activity in childhood was se…

AdultMaleAdolescentPhysical activityphysical activityPhysical Therapy Sports Therapy and RehabilitationDevelopmental psychology03 medical and health sciences0302 clinical medicinechildren0502 economics and businessadultsHumansOrthopedics and Sports MedicineLongitudinal Studies050207 economicsChildta315Exerciseta512Finlandaikuisetta511Earnings05 social scienceshealth030229 sport sciencesPhysical activity levelIncomeFemalelabor marketPsychologyterveysearningsMedicine and Science in Sports and Exercise
researchProduct

Predicting the age at natural menopause in middle-aged women

2021

Objective To predict the age at natural menopause (ANM). Methods Cox models with time-dependent covariates were utilized for ANM prediction using longitudinal data from 47 to 55-year-old women (n = 279) participating in the Estrogenic Regulation of Muscle Apoptosis study. The ANM was assessed retrospectively for 105 women using bleeding diaries. The predictors were chosen from the set of 32 covariates by using the lasso regression (model 1). Another easy-to-access model (model 2) was created by using a subset of 16 self-reported covariates. The predictive performance was quantified with c-indices and by studying the means and standard deviations of absolute errors (MAE ± SD) between the pre…

final menstrual periodelintavatvaihdevuodetAlcohol DrinkingGeneral MathematicsConcordancemedia_common.quotation_subjectkeski-ikäkuukautiset030209 endocrinology & metabolismOriginal Studies03 medical and health sciencesMenopause prediction0302 clinical medicineSex hormone-binding globulinCovariateHumansMedicineMenopausal transitiontilastolliset mallitSocioeconomic statusMenstrual CycleMenstrual cycleProportional Hazards ModelsRetrospective Studiesmedia_commonperimenopause030219 obstetrics & reproductive medicinebiologyVasomotorbusiness.industryProportional hazards modelpremenopause.Applied Mathematicsmenopausal transitionObstetrics and GynecologyennusteetMiddle AgedPerimenopausePremenopauseHormonal contraceptionbiology.proteinFinal menstrual periodFemaleMenopausebusinessmenopause predictionDemographyMenopause
researchProduct

Childhood physical activity as a labor market investment

2020

This study examined the role of physical activity and changes in physical activity levels during childhood in long-term labor market outcomes. To address this important but under-researched theme, the study utilized data drawn from longitudinal research, the Cardiovascular Risk in Young Finns Study (YFS), and from registries compiled by Statistics Finland. The study consisted of children aged 9 (n = 1565) and 15 (n = 2445) at the time their physical activity was measured. Labor market outcomes, including employment status, average employment months, and average unemployment months, were calculated from 1997 to 2010, when the participants were aged 20 to 48 years. Regression models were used…

AdultEmploymentIndex (economics)Adolescentmedia_common.quotation_subjectPhysical activityPhysical Therapy Sports Therapy and Rehabilitation030204 cardiovascular system & hematologyYoung Adult03 medical and health sciencesChild DevelopmentSex Factors0302 clinical medicineHumansOrthopedics and Sports MedicineLongitudinal StudiesRegistriesChildExerciseFinlandmedia_commonRegression analysis030229 sport sciencesMiddle AgedInvestment (macroeconomics)Unemployment8. Economic growthUnemploymentRegression AnalysisSelf ReportPsychologyDemographyScandinavian Journal of Medicine &amp; Science in Sports
researchProduct

Physical activity is positively related to local functional connectivity in adolescents’ brains

2021

AbstractAdolescents have experienced decreased aerobic fitness levels and insufficient physical activity levels over the past decades. While both physical activity and aerobic fitness are related to physical and mental health, little is known concerning how they manifest in the brain during this stage of development, characterized by significant physical and psychosocial changes. Previous investigations have demonstrated associations of physical activity and aerobic fitness with the brain’s functional connectivity in both children and adults. However, it is difficult to generalize these results to adolescents because the development of functional connectivity has unique features during adol…

Functional connectivityPhysical activityPsychologyNeuroscience
researchProduct

Test-retest reliability of adolescents' self-reported physical activity item in two consecutive surveys.

2019

Background National monitoring of school-aged physical activity (PA) behaviours is necessary to inform policy makers. The Finnish School-aged Physical Activity (FSPA – LIITU in Finnish) is a physical activity monitoring study, collecting data from young adolescents aged 11 to 15 years through a nationally representative sample. This study included a single self-reported item question on moderate to vigorous intensity physical activity (MVPA) from the preceding seven days. The question is used widely in the WHO Collaborative Cross-National Health Behaviour in School-aged Children (HBSC) study as a measure of meeting international PA recommendations. This study evaluated the test-retest relia…

medicine.medical_specialtyepidemiologic monitoring030309 nutrition & dieteticseducationPhysical activitykyselytutkimusphysical activityliikuntaAdolescentsYoung adolescentsContinuous variable03 medical and health sciences0302 clinical medicinenuoretquestionnaire designmedicineadolescents030212 general & internal medicineReliability (statistics)itsearviointi0303 health sciencesPhysical activityResearchlcsh:Public aspects of medicinePublic healthPublic Health Environmental and Occupational HealthHealth services researchlcsh:RA1-1270self-reportTest (assessment)Epidemiologic monitoringQuestionnaire designPsychologySelf-reportKappaDemographyArchives of public health = Archives belges de sante publique
researchProduct

Changes in physical activity and sedentary time in the Finnish Schools on the Move program: a quasi-experimental study

2017

The aim of the Finnish Schools on the Move program is to create a more active and pleasant school day through physical activity (PA). In this quasi-experimental design, we compared changes in moderate-to-vigorous-intensity physical activity (MVPA) and sedentary time (ST) during the school day and outside school hours for Grades 1–9 over two academic years in four program schools and two reference schools. Altogether 319 girls and boys aged 7–15 participated in the study between 2010 and 2012. MVPA and ST were measured four times over the 1.5-year follow-up period for seven consecutive days, using a hip-worn ActiGraph accelerometer. Linear growth curve modeling was used to examine the effect…

Malemedicine.medical_specialtyAdolescenteducationPhysical activityPhysical Therapy Sports Therapy and RehabilitationHealth Promotionschoolsistuminen03 medical and health sciencesLeisure Activities0302 clinical medicinechildrensedentary behaviorSuomiQuasi experimental studymedicineHumansOrthopedics and Sports Medicineadolescents030212 general & internal medicineMotor activityChildta315ExerciseFinlandSedentary timeeducationkoulutmotor activityMove programActigraphy030229 sport sciencesSedentary behaviorActigraphyHealth promotionPhysical therapyFemaleLinear growthPsychologyhuman activitiesfyysinen aktiivisuusDemographyScandinavian Journal of Medicine &amp; Science in Sports
researchProduct

Associations of neck and shoulder pain with objectively measured physical activity and sedentary time among school-aged children

2020

Abstract Objectives The potential effects of physical activity and sedentary time on children’s increasing neck and shoulder pain are unclear. The aim of this cross-sectional study was to evaluate the associations between objectively measured physical activity or sedentary time and neck and shoulder pain in children. Methods Children (n=905; 10–15 years old) filled in an electronic questionnaire during school hours on the frequency of their neck and shoulder pain. Daytime moderate to vigorous physical activity and sedentary time were measured objectively with an ActiGraph accelerometer. A multinomial logistic regression was applied to study the associations. The results were adjusted for ag…

MaleMusculoskeletal painmedicine.medical_specialtyhartiatPhysical activitylapset (ikäryhmät)liikuntaBedtimeistuminen03 medical and health sciences0302 clinical medicineShoulder Painsedentary behaviorAccelerometryaccelerometryHumansDaily livingMedicinepain030212 general & internal medicineSex DistributionChildExercisePain symptomsSedentary timechildNeck PainSchool age childexercisebusiness.industrykipuniska030229 sport sciencesCross-Sectional StudiesAnesthesiology and Pain MedicinePhysical therapyFemaleNeurology (clinical)Sedentary BehaviorbusinessBody mass indexfyysinen aktiivisuus
researchProduct

Results from Finland’s 2014 Report Card on Physical Activity for Children and Youth

2014

The Finnish 2014 Report Card on Physical Activity (PA) for Children and Youth is the first assessment of Finland’s efforts in promoting and facilitating PA opportunities for children and youth using the Active Healthy Kids Canada grading system. The Report Card relies primarily on research findings from 6 Research Institutes, coordinated by the University of Jyväskylä. The Research Work Group convened to evaluate the aggregated evidence and assign grades for each of the 9 PA indicators, following the Canadian Report Card protocol. Grades from A (highest) to F (lowest) varied in Finland as follows: 1) Overall physical activity—fulfillment of recommendations (D), 2) Organized sport participat…

MaleGerontologymedicine.medical_specialtyAdolescentChild WelfarePoison controlHealth PromotionLevel designMotor ActivitySuicide preventionOccupational safety and healthSocial supportKnowledge translationInjury preventionmedicineHumansOrthopedics and Sports MedicineChildExerciseFinlandConsumer AdvocacySchoolsHealth PolicySocial SupportPlay and PlaythingsHealth CommunicationPhysical therapyEnvironment DesignFemaleSedentary BehaviorPsychologyReport cardProgram EvaluationSportsJournal of Physical Activity and Health
researchProduct

Tracking and Changes in Daily Step Counts among Finnish Adults

2021

Purpose This study aimed to investigate the tracking and changes of steps per day in adults and their determinants over 13 yr. Methods A total of 2195 subjects (1236 women) 30-45 yr of age were randomly recruited from the ongoing Cardiovascular Risk in Young Finns Study in 2007 and were followed up in 2020. Steps per day, including both total and aerobic steps per day, were monitored for seven consecutive days with a pedometer in 2007-2008 and 2011-2012 and with an accelerometer in 2018-2020. Tracking was analyzed using Spearman's correlation. Stability and changes of steps per day over time in both low-active and high-active groups (based on median values) were described by percentage agre…

MaleDEVICESEpidemiologyPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusADULTHOODFitness TrackersWalkingLogistic regressionBody Mass Index3123 Gynaecology and paediatricsMedicineHumansOrthopedics and Sports MedicineAMBULATORY ACTIVITYLongitudinal StudiesaskelmittaritaikuisetFinlandMULTILEVEL ANALYSISSTABILITYbusiness.industryFemale sexAge cohortsMiddle AgedActigraphy3142 Public health care science environmental and occupational healthPedometerAmbulatoryFemalebusinessLinear growthBody mass indexAGE COHORTSfyysinen aktiivisuusDemographyMedicine and Science in Sports and Exercise
researchProduct

Does Childhood Temperamental Activity Predict Physical Activity and Sedentary Behavior over a 30-Year Period? Evidence from the Young Finns Study

2016

We examined associations between childhood temperamental activity, physical activity (PA), and television (TV) viewing over a 30-year period. The participants (1220 boys and 1237 girls) were aged 3, 6, 9, and 12 years in 1980 and were followed until 2011. Temperamental activity was evaluated by participants' mothers at baseline. The PA was assessed based on maternal ratings of the child from ages 3 to 6 and via self-report age from the age of 9 across all measurements. TV viewing was assessed using self-reports taken from 2001 to 2011. The associations between temperamental activity and the level and change of PA and TV viewing were determined using linear growth modeling stratified by gend…

AdultMaleBODY-COMPOSITIONAdolescent515 Psychologymedia_common.quotation_subjectPhysical activityMothersHYPERACTIVITYADULTHOODAGED 0-4 YEARSDevelopmental psychologyAge and gender03 medical and health sciencesYoung AdultTRACKING0302 clinical medicinePersonalityHumans030212 general & internal medicineTv viewingChildTemperamentExerciseApplied PsychologyFinlandmedia_commonTemperamental activityASSOCIATIONSPERSONALITYPhysical activityFollow-upCARDIOVASCULAR RISK030229 sport sciencesSedentary behaviorHealth psychologySedentary behaviorChild PreschoolFemaleTelevisionSelf ReportHEALTHPsychologyLinear growthDemographyFollow-Up Studies
researchProduct

Test-retest repeatability of questionnaire for pain symptoms for school children aged 10–15 years

2019

Abstract Background and aims There is a growing body of evidence, that pain is common at school age. Less is known about the repeatability of pain questionnaires for children. This study aimed to assess the test-retest repeatability of the Finnish version of the electronic pain questionnaire for school-aged children. Methods Primary (n = 79) and lower secondary (n = 127) schoolchildren aged 10–15 years from two schools from the Jyväskylä region of Finland, filled in an electronic questionnaire twice in an interval of 2 weeks. It captured the frequency of pain symptoms with a five-point Likert-scale questionnaire covering nine areas of the body for the last 3 months. The intraclass correlati…

MaleShouldermedicine.medical_specialtyAdolescentIntraclass correlationkyselytutkimuslapset (ikäryhmät)03 medical and health sciences0302 clinical medicinechildrenSurveys and QuestionnairesHumansMedicine030212 general & internal medicineChildFinlandPain symptomsInternetSchoolsSchool age childbusiness.industrytoistettavuusquestionnaireChronic painReproducibility of Resultskipu030206 dentistryRepeatabilitymedicine.diseaseTest (assessment)Anesthesiology and Pain MedicinePain frequencyPhysical therapyFemaleNeurology (clinical)Chronic PainbusinessHeadNeck
researchProduct

Longitudinal associations between parental and offspring's leisure-time physical activity: The Young Finns Study.

2021

Purpose The longitudinal influence of parental leisure-time physical activity (LTPA) on their offspring's LTPA is poorly understood. This study examined the longitudinal associations between parental LTPA and offspring's LTPA at two-time intervals. Method Child (offspring) participants (N=3596) were enrolled from the Cardiovascular Risk in Young Finns Study in 1980. Their LTPA was self-rated through nine phases from baseline to 2018 and categorized by year into youth (1980-1986) and adult (1992-2018) LTPA. Parental LTPA was assessed with a single self-reported question at three phases from 1980 to 1986. Latent growth curve modeling stratified by gender was fitted to estimate the potential p…

AdultMaleParentsAdolescentbusiness.industryLatent growth modelingOffspringLeisure timePhysical activityPhysical Therapy Sports Therapy and RehabilitationLife stageBody Mass IndexLeisure ActivitiesMedicineHumansOrthopedics and Sports MedicineFemalebusinesshuman activitiesBody mass indexExerciseFinlandDemographyScandinavian journal of medicinescience in sportsREFERENCES
researchProduct

Towards a physically more active lifestyle based on one's own values: study design of a randomized controlled trial for physically inactive adults

2013

Background This randomised controlled trial demonstrates the effectiveness of a value-based intervention program to encourage a physically more active lifestyle among physically inactive adults aged 30 to 50 years. The conceptual framework of the program is based on an innovative behavioural therapy called Acceptance and Commitment Therapy (ACT) that aims to increase an individual’s psychological flexibility and support behaviour change towards a higher quality and more meaningful life. Methods Participants will be randomly allocated to a feedback group (FB) or an Acceptance and Commitment based (ACT + FB) group. Both the groups will receive written feedback about their objectively measured…

GerontologyAdultMalemedicine.medical_treatmenthyväksymis- ja omistautumisterapiaEffectivenessPersonal SatisfactionAcceptance and commitment therapyMeaningful lifePsychological well-beinglaw.inventionStudy ProtocolRandomized controlled trialPsykologinen hyvinvointilawSurveys and QuestionnairesmedicineHumansAdultsBehaviourAcceptance and Commitment TherapykäyttäytyminenExerciseaikuisetSedentary lifestyleHOTMotivationCognitive Behavioral Therapybusiness.industryPhysical activitytuloksellisuusPublic Health Environmental and Occupational HealthFlexibility (personality)Middle AgedvaikuttavuusACTPsychological well-beingCognitive therapyFemaleBiostatisticsSedentary BehaviorbusinessAttitude to Healthfyysinen aktiivisuus
researchProduct

Convergent Validity of a Physical Activity Questionnaire against Objectively Measured Physical Activity in Adults: The Cardiovascular Risk in Young F…

2017

Background: Traditionally, a self-reported questionnaire has been a cost-effective method of gathering information about physical activity (PA). An objective measurement, such as the use of a pedometer, can be used to validate the findings of a PA questionnaire in a large population. Objective: The study objective was to determine the convergent validity of a PA questionnaire against objectively measured PA in adults obtained with the use of a pedometer. Methods: Data from the Cardiovascular Risk in Young Finns Study (YFS) were collected from 1853 participants aged 30 - 45 years. The participants completed a self-reported questionnaire that included items on leisure time, commuting and habi…

Gerontologymedicine.medical_specialtyLeisure timeAdult populationLarge populationPhysical activityphysical activityliikuntaMetabolic equivalent03 medical and health sciences0302 clinical medicineadultsMedicine030212 general & internal medicineta315aikuisetpedometerbusiness.industryquestionnaireObjective measurementtotal stepsta3141030229 sport sciencesGeneral MedicineConvergent validityPedometersydän- ja verisuonitauditPhysical therapybusinessfyysinen aktiivisuusaerobic stepsAdvances in Physical Education
researchProduct

Aerobic fitness, but not physical activity, is associated with grey matter volume in adolescents.

2019

Higher levels of aerobic fitness and physical activity are linked to beneficial effects on brain health, especially in older adults. The generalizability of these earlier results to young individuals is not straightforward, because physiological responses (such as cardiovascular responses) to exercise may depend on age. Earlier studies have mostly focused on the effects of either physical activity or aerobic fitness on the brain. Yet, while physical activity indicates the amount of activity, aerobic fitness is an adaptive state or attribute that an individual has or achieves. Here, by measuring both physical activity and aerobic fitness in the same study, we aimed to differentiate the assoc…

GerontologyMalephysical activityBehavioral Neuroscience0302 clinical medicinenuoretExercise/physiologyMedicinemagneettitutkimusaivotutkimusGray Matterta315Childaerobic fitness0303 health sciencesBrain Mappingcardiorespiratory fitnesssydänmagneettikuvausMagnetic Resonance Imagingbrain researchAdolescencemedicine.anatomical_structureaerobinen suorituskykyFemaleaivotfyysinen aktiivisuusAdolescentbrainPhysical activityGrey matterta311203 medical and health sciencesMagnetic resonance imagingAerobic exerciseHumansGeneralizability theoryBrain/pathologyCardiorespiratory fitnessExerciseBeneficial effects030304 developmental biologyAgedbusiness.industryPhysical activityaerobic capacityAccelerometeraccelerometerVolume (thermodynamics)adolescenceSedentary Behaviorbusiness030217 neurology & neurosurgeryGray Matter/physiologyBehavioural Brain Research
researchProduct

Parental Physical Activity Associates With Offspring's Physical Activity Until Middle Age: A 30-Year Study.

2017

Background:Parents’ physical activity associates with their children’s physical activity. Prospective designs assessing this association are rare. This study examined how parents’ physical activity was associated with their children’s physical activity from childhood to middle adulthood in a 30-year prospective, population-based setting.Methods:Participants (n = 3596) were from the ongoing Cardiovascular Risk in Young Finns study started in 1980. Participants’ physical activity was self-reported at 8 phases from 1980 to 2011, and their parents’ physical activity at 1980. Analyses were adjusted for a set of health-related covariates assessed from 1980 to 2007.Results:High levels of mothers’ …

AdultMaleParentsAdolescent515 PsychologyOffspringPARTICIPATIONPopulationCHILDHOODPhysical activityADULTHOOD030204 cardiovascular system & hematologycommunity-based researchDevelopmental psychology03 medical and health sciencesSocial support0302 clinical medicinehealth behaviorchildrenRisk FactorsADOLESCENTSHumansLIFE EXPECTANCYOrthopedics and Sports MedicineMeasurement invariance030212 general & internal medicineLongitudinal StudiesProspective StudieseducationChildExerciseeducation.field_of_studyMiddle AgedSport psychologyMiddle agesport psychologyMEASUREMENT INVARIANCEYOUNG FINNSLife expectancyFemaleHEALTHSOCIAL SUPPORTPsychologyBEHAVIORDemographyJournal of physical activityhealth
researchProduct

Associations of subjective social status with accelerometer-based physical activity and sedentary time among adolescents

2019

This study examined the associations of subjective social status (SSS) with physical activity (PA) and sedentary time (ST) among adolescents. The study population consisted of 420 Finnish adolescents aged 13 to 14 years. The adolescents reported their own SSS within their school (school SSS) and their family's social position within society (society SSS) based on the youth version of the Subjective Social Status Scale. Adolescents' moderate- to vigorous-intensity physical activity (MVPA) and ST were measured objectively by accelerometers and analyzed separately for the whole day and the school day. The associations between SSS and MVPA and ST outcomes were analyzed using multilevel modeling…

MaleParentsAdolescenteducationHealth Behaviorsedentary timePhysical activityphysical activity030209 endocrinology & metabolismPhysical Therapy Sports Therapy and Rehabilitationsosiaalinen asema03 medical and health sciences0302 clinical medicinenuoretNegatively associatedhealth behaviourAccelerometryaccelerometrySocial positionHumansOrthopedics and Sports MedicineSocial determinants of healthta315ExerciseFinlandSedentary timeyouthMultilevel model030229 sport sciencesta3142social statusSSS*Cross-Sectional StudiesSocial ClassAdolescent BehaviorterveyskäyttäytyminennuoruusFemaleSedentary BehaviorPsychologyhuman activitiesfyysinen aktiivisuusClinical psychologySocial status
researchProduct

Physical activity and aerobic fitness show different associations with brain processes underlying anticipatory selective visuospatial attention in ad…

2021

ABSTRACTUnderlying brain processes of exercise-related benefits on executive functions and the specific contribution of physical activity vs. aerobic fitness are poorly understood, especially during adolescence. We explored whether and how physical activity and aerobic fitness are associated with selective attention and the oscillatory dynamics induced by an anticipatory spatial cue. Further, we studied whether the link between physical exercise level and cognitive control in adolescents is mediated by the task-related oscillatory activity. Magnetoencephalographic alpha oscillations during a modified Posner’s cueing paradigm were measured in 59 adolescents (37 females and 22 males, 12 to 17…

magnetoencephalographykognitiiviset taidot0301 basic medicinePhysical activity.statusvaikutuksetselective attentionPhysical activityphysical activityAlpha (ethology)Physical exerciseliikuntaDevelopmental psychology03 medical and health sciences0302 clinical medicinenuoretmedicineAerobic exerciseaivotutkimusanticipatory alpha oscillationsAssociation (psychology)Molecular Biologyaerobic fitnessAnticipatory alpha oscillationsmedicine.diagnostic_testPhysical activityGeneral NeuroscienceMagnetoencephalographyCognitionMagnetoencephalographyaerobinen harjoitteluExecutive functionsAdolescencefyysinen kunto030104 developmental biologyAerobic fitnessadolescenceSelective attentionNeurology (clinical)aivotPsychologyfyysinen aktiivisuus030217 neurology & neurosurgeryDevelopmental BiologyBrain Research
researchProduct

Physical Activity, Sleep, and Symptoms of Depression in Adults - Testing for Mediation

2019

Abstract Purpose: Physical activity, sleep problems, and symptoms of depression contribute to overall well-being. The factors are reciprocally associated, but the nature of these associations remains unclear. The present study examined whether sleep problems mediated the association between physical activity and depressive symptoms. Methods: The eligible population (n = 3596) consisted of adults from the ongoing, population-based Cardiovascular Risk in Young Finns Study started in 1980. Participants’ leisure-time physical activity was assessed with physical activity index (2007) and sleep problems with Jenkins’ Sleep Questionnaire in 2007 and 2011. Depressive symptoms were measured using mo…

AdultMaleSleep Wake DisordersmasennusMediation (statistics)causalityleisure-time physical activiry515 PsychologyPhysical activityLEISURE-TIME PHYSICAL ACTIVITYCHILDHOODPhysical Therapy Sports Therapy and RehabilitationEXERCISECAUSALITYliikuntaleisure-time physical activity03 medical and health sciences0302 clinical medicineSurveys and QuestionnairesInsomniamedicineHumansOrthopedics and Sports MedicineProspective Studies10. No inequalityProspective cohort studyta315PREDICTORSDepression (differential diagnoses)ta515unihäiriötSLEEP PROBLEMSsleep problemsbusiness.industryCARDIOVASCULAR RISK030229 sport sciencesta3142Middle AgedDEPRESSIONSleep in non-human animalsINSOMNIAdepressionkausaliteettiFemalemedicine.symptombusinessfyysinen aktiivisuusClinical psychology
researchProduct

Longitudinal associations of physical activity and pubertal development with academic achievement in adolescents.

2020

Highlights • Boys with higher levels of moderate-to-vigorous physical activity had better academic achievement than those with lower levels of physical activity at baseline. • Physical activity was not associated with academic achievement at follow-up in boys or girls. • Continuously inactive adolescents had poorer academic achievement over the follow-up period than their more active peers. • Girls with more advanced pubertal status had better academic achievement than other girls.

cognitionMalephysical activityAcademic achievementAdolescents0302 clinical medicineCognitionnuoretMedicineOrthopedics and Sports Medicine030212 general & internal medicineadolescentsLongitudinal StudiesChildChildrenFinlandAcademic SuccessexerciseBrainmurrosikäFemalelcsh:RC1200-1245fyysinen aktiivisuusopintomenestyskognitiiviset taidotAdolescentbrainPhysical activityPhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)Article03 medical and health scienceslcsh:GV557-1198.995Sex FactorschildrenHumanslcsh:Sports medicineExerciselcsh:Sportsbusiness.industryPhysical activityPubertyHealth behaviour030229 sport sciencesConfidence intervalSelf ReportMaturitySedentary BehaviorbusinessmaturityDemographyFollow-Up StudiesJournal of sport and health science
researchProduct

Female reproductive factors are associated with objectively measured physical activity in middle-aged women

2017

Physical activity improves health and may delay the onset of several chronic diseases. For women in particular, the rate of these diseases accelerates at middle age; therefore it is important to identify the determinants of health-enhancing physical activity during midlife in this population. In this study, we focused on determinants that are unique to the female sex, such as childbearing and menopause. The main objective was to characterize the level of physical activity and differences between active and inactive middle-aged Finnish women. In addition, we examined the association of physical activity with female reproductive factors at midlife. The study population consisted of 647 women …

vaihdevuodetPhysiologyMaternal Healthlcsh:Medicinephysical activitymenopauseMiscarriageBody Mass Index0302 clinical medicineMathematical and Statistical TechniquesPregnancyAccelerometryMedicine and Health SciencesMedicinePublic and Occupational Healthpelvic floor dysfunction030212 general & internal medicinelcsh:Scienceta315Reproductive HistoryFinlandeducation.field_of_study030219 obstetrics & reproductive medicineMultidisciplinaryPelvic floorObstetrics and Gynecologyta3142Middle AgedMenopausemedicine.anatomical_structurePhysiological ParametersCohortPhysical SciencesEngineering and TechnologyRegression AnalysisFemaleStatistics (Mathematics)Research ArticleUrologyPopulationLinear Regression AnalysisResearch and Analysis MethodsPelvic Floor Disordersmiddle-aged women03 medical and health sciencesPelvic floor dysfunctionPain ManagementHumansObesityStatistical MethodseducationExerciseIncontinencebusiness.industryBody Weightlcsh:RBiology and Life SciencesMyalgiaPelvic Floormedicine.diseaseta3123Middle agePregnancy ComplicationsLight intensityWomen's Healthlcsh:QElectronicsAccelerometersbusinessBody mass indexMathematicsDemographyPLoS ONE
researchProduct

Associations of partnering transition and socioeconomic status with a four-year change in daily steps among Finnish adults.

2018

Aim: The aim of this prospective four-year follow-up study was to examine how socioeconomic status (SES) and change in marital status are associated with the change in pedometer-measured physical activity (PA) in adulthood among participants in the ‘Cardiovascular Risk in Young Finns Study’. Methods: Questionnaires were completed and pedometers worn at baseline in 2007 and again at follow-up in 2011 by 1051 Finnish adults (62.3% female, aged 30–45 years in 2007). A latent change score model was used to examine mean change in daily total steps, aerobic steps and non-aerobic steps during weekdays and weekend days between 2007 and 2011. Results: In women re-coupling or finding a new partner wa…

AdultMalePopulationAdult populationPhysical activityWalking03 medical and health sciences0302 clinical medicineSurveys and QuestionnairesMedicineHumans030212 general & internal medicineProspective StudieseducationSocioeconomic statusFinlandChange scoreeducation.field_of_study030505 public healthMarital Statusbusiness.industryPublic Health Environmental and Occupational Healthta3142General Medicineta3121Middle AgedActigraphySocial ClassPedometerMarital statusFemale0305 other medical sciencebusinessDemographyFollow-Up StudiesScandinavian journal of public health
researchProduct

Associations Between Trajectories of Leisure-Time Physical Activity and Television Viewing Time Across Adulthood: The Cardiovascular Risk in Young Fi…

2018

Background: The purpose of this study was to examine trajectories of leisure-time physical activity (LTPA) and television-viewing (TV) time and their associations in adults over 10 years. Methods: The sample comprised 2934 participants (men, 46.0%) aged 24–39 years in 2001 and they were followed up for 10 years. LTPA and TV time were assessed using self-report questionnaires in 2001, 2007, and 2011. Longitudinal LTPA and TV-time trajectories and their interactions were analyzed with mixture modeling. Results: Three LTPA (persistently highly active, 15.8%; persistently moderately active, 60.8%; and persistently low active, 23.5%) and 4 TV time (consistently low, 38.6%; consistently moderate,…

AdultMaleTelevision viewingmedicine.medical_specialtyAdolescentLeisure timePhysical activityruutuaikaliikuntaCardiovascular SystemBody Mass IndexTimeistuminenCardiovascular Physiological PhenomenaScreen timeYoung AdultRisk Factorssedentary behaviorSurveys and QuestionnairesEpidemiologyMedicineHumansOrthopedics and Sports MedicineepidemiologiaExerciseFinlandexercisebusiness.industrytelevisio (joukkoviestimet)SmokingSedentary behaviorMiddle Agedtelevision katseluaikuisuusCardiovascular Diseasesscreen timeMixture modelingRecreationepidemiologyFemaleTelevisionSelf ReportSedentary Behaviorbusinesshuman activitiesBody mass indexvapaa-aikafyysinen aktiivisuusDemographyJournal of physical activityhealth
researchProduct

Physical Activity, Sedentary Behavior, and Academic Performance in Finnish Children

2013

Purpose: This study aimed to determine the relationships between objectively measured and self-reported physical activity, sedentary behavior, and academic performance in Finnish children. Methods: Two hundred and seventy-seven children from five schools in the Jyväskylä school district in Finland (58% of the 475 eligible students, mean age = 12.2 yr, 56% girls) participated in the study in the spring of 2011. Self-reported physical activity and screen time were evaluated with questions used in the WHO Health Behavior in School-Aged Children study. Children’s physical activity and sedentary time were measured objectively by using an ActiGraph GT1M/GT3X accelerometer for seven consecutive da…

GerontologyEducational measurementkouluikäoppiminenmoderate-to-vigorous physical activityPhysical activityruutuaikaPhysical Therapy Sports Therapy and RehabilitationSedentary behaviorAcademic achievementSchool districtacademic achievementScreen timeschool ageLinear regressionOrthopedics and Sports MedicineAnalysis of variancekoulumenestysta315Psychologyfyysinen aktiivisuusta515Medicine &amp; Science in Sports &amp; Exercise
researchProduct

Physical Inactivity from Youth to Adulthood and Risk of Impaired Glucose Metabolism

2018

Introduction: Physical activity (PA) is important in the prevention and treatment of impaired glucose metabolism. However, association of physical inactivity during the transition between childhood and adulthood with glucose metabolism is unknown. Therefore, we studied the association of persistent physical inactivity since childhood with glucose metabolism in adulthood. Methods: Data were drawn from the ongoing, Cardiovascular Risk in Young Finns Study with repeated follow-ups between 1980 and 2011 (baseline age, 3-18 yr; n = 3596). Impaired glucose metabolism was defined as having impaired fasting glucose (6.1-6.9 mmol·L-1) or type 2 diabetes in adulthood. Leisure-time PA habits were repe…

Blood GlucoseMaleCross-sectional studyphysical activityType 2 diabetes030204 cardiovascular system & hematology0302 clinical medicineRisk FactorsSurveys and QuestionnairesOrthopedics and Sports MedicineLongitudinal Studies030212 general & internal medicineta315impaired glucose metabolismChildFinlandliikkumattomuusta3142Middle AgedaikuisuusChild PreschoolFemalefyysinen aktiivisuusAdultmedicine.medical_specialtyAdolescentPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusCarbohydrate metabolism03 medical and health sciencesaineenvaihduntahäiriötInternal medicineDiabetes mellitusmedicineHumansExerciseLife Stylechildhoodbusiness.industryMetabolismlapsuusta3121medicine.diseaseImpaired fasting glucoseConfidence intervalCross-Sectional StudiesGlucoseEndocrinologyDiabetes Mellitus Type 2Relative riskphysical inactivitySedentary Behaviorbusinessaikuistyypin diabetesMedicine &amp; Science in Sports &amp; Exercise
researchProduct

Long-term Leisure-time Physical Activity and Serum Metabolome

2013

Background— Long-term physical inactivity seems to cause many health problems. We studied whether persistent physical activity compared with inactivity has a global effect on serum metabolome toward reduced cardiometabolic disease risk. Methods and Results— Sixteen same-sex twin pairs (mean age, 60 years) were selected from a cohort of twin pairs on the basis of their &gt;30-year discordance for physical activity. Persistently (≥5 years) active and inactive groups in 3 population-based cohorts (mean ages, 31–52 years) were also studied (1037 age- and sex-matched pairs). Serum metabolome was quantified by nuclear magnetic resonance spectroscopy. We used permutation analysis to estimate the …

AdultBlood GlucoseMalemedicine.medical_specialtyMultivariate statisticsAdolescentLipoproteinsPopulationPhysiologyPhysical exerciseMotor Activity030204 cardiovascular system & hematologyCohort StudiesYoung Adult03 medical and health sciencesLeisure Activities0302 clinical medicineBlood serumPhysiology (medical)Internal medicineTwins DizygoticmedicineMetabolomeHumansIsoleucineta315education030304 developmental biology2. Zero hunger0303 health scienceseducation.field_of_studybusiness.industryFatty Acidsta3141Twins Monozygoticta3121Middle AgedTwin studyEndocrinologyCohortMetabolomeFemaleCardiology and Cardiovascular MedicinebusinessCohort studyCirculation
researchProduct

Income and Physical Activity among Adults: Evidence from Self-Reported and Pedometer-Based Physical Activity Measurements

2015

This study examined the relationship between income and physical activity by using three measures to illustrate daily physical activity: the self-reported physical activity index for leisure-time physical activity, pedometer-based total steps for overall daily physical activity, and pedometer-based aerobic steps that reflect continuous steps for more than 10 min at a time. The study population consisted of 753 adults from Finland (mean age 41.7 years; 64% women) who participated in 2011 in the follow-up of the ongoing Young Finns study. Ordinary least squares models were used to evaluate the associations between income and physical activity. The consistency of the results was explored by us…

tulotGerontologyAdultMaleLiikuntatiede - Sport and fitness sciencesHealth StatusPhysical activityphysical activitylcsh:MedicineMotor ActivityNegatively associatedadultsHumansLongitudinal Studiesta315Self reportlcsh:Scienceaikuisetta511MultidisciplinaryInstrumental variablelcsh:RMean ageMiddle Agedta3121Health SurveysSocioeconomic FactorsPedometerOrdinary least squaresIncomePopulation studyFemalelcsh:QSelf ReportPsychologyDemographyResearch ArticlePLoS ONE
researchProduct

Motivational characteristics and resistance training in older adults: A randomized controlled trial and 1-year follow-up

2018

The aim of this study was to investigate the effects of a 9‐month supervised resistance training intervention on motivational and volitional characteristics related to exercise, and whether the absolute level and/or intervention‐induced change in these characteristics predict self‐directed continuation of resistance training 1 year after the intervention. Community dwelling older adults aged 65‐75, who did not fulfill physical activity recommendations, were randomized into resistance training intervention groups: training once‐ (n = 26), twice‐ (n = 27), three‐times‐a‐week (n = 28) or non‐training control group (n = 25). Training groups participated in supervised resistance training for 9 m…

Malemedicine.medical_specialtyStrength trainingeducationvanhuksetPhysical activityphysical activityPhysical Therapy Sports Therapy and Rehabilitation1 year follow upvolitionliikuntaphysical activenesslaw.invention03 medical and health sciences0302 clinical medicinemotivationtahtoRandomized controlled triallawSurveys and QuestionnairesIntervention (counseling)strength trainingmedicineHumansIntrinsic motivationOrthopedics and Sports Medicine030212 general & internal medicineta315FinlandAgedmotivaatioexercisekuntoliikuntabusiness.industryCoping planningagingResistance trainingResistance Training030229 sport sciencesSelf EfficacyikääntyminenPhysical therapyFemalevoimaharjoittelubusinessfyysinen aktiivisuusFollow-Up StudiesScandinavian Journal of Medicine &amp; Science in Sports
researchProduct

Sedentary behaviours and obesity in adults: the Cardiovascular Risk in Young Finns Study

2013

Objective Sedentary behaviour may contribute to the development of obesity. We investigated the relations between different types of sedentary behaviour and adiposity markers in a well-characterised adult population after controlling for a wide range of potential confounders. Design Cross-sectional study. Setting The Cardiovascular Risk in Young Finns Multicenter Study. Participants Sedentary time (TV viewing, computer time, reading, music/radio listening and other relaxation) was assessed with a questionnaire for 1084 women and 909 men aged 30–45 years. Other study variables included occupational and leisure-time physical activity, sleep duration, socioeconomic status, smoking, alcohol con…

Gerontology1683medicine.medical_specialtyWaistSports medicineEpidemiologySPORTS MEDICINE030209 endocrinology & metabolism03 medical and health sciences0302 clinical medicinePREVENTIVE MEDICINEEpidemiologymedicine1724030212 general & internal medicine1506Socioeconomic statusPreventive healthcare2. Zero hungerbusiness.industryResearchConfoundingGeneral Medicinemedicine.diseaseObesity3142 Public health care science environmental and occupational health1692PUBLIC HEALTHbusinessBody mass indexBMJ Open
researchProduct

The effect of the cluster randomized HIPPA intervention on childcare children’s overall physical activity

2017

Background The effect of the cluster randomized Home- and childcare-based Intervention to Promote Physical Activity (HIPPA) intervention on the everyday physical activity (PA) of children between the ages of 4 to 5 years was evaluated. Material/Methods Fourteen childcare centers with 102 children born in 2007 and their families participated in the study. HIPPA was implemented over a single preschool year in seven childcare centers while seven other centers continued their normal care (control group, CG). The PA levels of children were assessed by accelerometers six times every six months during two and a half years of research. Valid PA data were obtained from 69 children at baseline and an…

medicine.medical_specialtyPhysical activityphysical activitychildcareliikuntaDisease clustersukupuolichildrenIntervention (counseling)medicinesexta516lapsetinterventiointerventionbiologyGeneral Engineeringta3141biology.organism_classificationHippaseksilastenhoitoPhysical therapyPsychologyfyysinen aktiivisuusBaltic journal of Health and Physical Activity
researchProduct

Active commuting from youth to adulthood and as a predictor of physical activity in early midlife: The Young Finns Study

2014

Abstract Objective The aims of the study were to describe the stability of active commuting (AC) behavior (i.e., walking and cycling) over 27 years and examine the relationship between AC and physical activity (PA) from youth to early midlife. Methods The mode and distance of travel were assessed using a self-reported questionnaire at five consecutive measurements between 1980 and 2007, when 2072 individuals were followed up from youth (9–18 years) to adulthood (30–45 years). PA was also measured using a questionnaire. Results The prevalence of AC declined sharply with age, particularly after 12 years, while AC distances to work or place of study increased substantially. AC was concurrently…

AdultMaleGerontologymedicine.medical_specialtyAdolescentEpidemiologyHealth BehaviorPhysical activityTransportationWalkingBody Mass IndexLife Change EventsYoung AdultSex FactorsSurveys and QuestionnairesPrevalenceHumansMedicineProspective StudiesYoung adultChildta315FinlandAnalysis of Variancebusiness.industryAge FactorsPublic Health Environmental and Occupational Healthta3121Middle AgedBicyclingSocial ClassPhysical therapyFemaleSelf ReportCyclingbusinessFollow-Up StudiesPreventive Medicine
researchProduct

Longitudinal physical activity trajectories from childhood to adulthood and their determinants: The Young Finns Study

2018

Determining lifelong physical activity (PA) trajectories and their determinants is essential to promote a physically active lifestyle throughout the life-course. We aimed to identify PA trajectories from childhood to midlife and their determinants in a longitudinal population-based cohort. This study is a part of the Cardiovascular Risk in Young Finns Study. From 1980, a population-based cohort (N = 3596; 1764 boys/1832 girls, age 3-18 years) has been followed up for 31 years. PA indices were formed based on self-reported data (between age 9-49 years) on frequency, duration, and intensity of leisure (during childhood) or high-intensity (at later age) PA and on sports club participation/comp…

MaleHealth Statusphysical activityAcademic achievement0302 clinical medicineMedicineOrthopedics and Sports MedicineLongitudinal Studies030212 general & internal medicineYoung adultChildta315FinlandActive groupReference groupaikuiseteducation.field_of_studyta3141ta3142Middle AgedaikuisuusChild PreschoolCohortFemaleHealth habitsfyysinen aktiivisuusAdultAdolescentlongitudinalPopulationPhysical activityPhysical Therapy Sports Therapy and RehabilitationYoung Adult03 medical and health sciencesHumanstrajectorieseducationExerciseLife Stylelapsetbusiness.industry030229 sport scienceslapsuusta3121ta3123behaviourpopulation-basedlatent class growth modellingSelf ReportbusinessDemographyScandinavian Journal of Medicine and Science in Sports
researchProduct

Longitudinal associations of fundamental movement skills with objectively measured physical activity and sedentariness during school transition from …

2017

Abstract Objectives This study aimed to investigate cross-lagged associations of leaping skill and throwing–catching skills with objectively measured moderate-to-vigorous physical activity (MVPA) and sedentary time (ST) during school transition from upper primary (Grade 6) to lower secondary school (Grade 7). Design This study is a one-year prospective follow-up study within Finnish school settings. Students’ MVPA, ST, leaping skill and throwing–catching skills were measured at Grade 6 and subsequently at Grade 7. Methods A sample of 336 students (163 girls, 173 boys; M age = 12.0 years, SD = 0.4 at Grade 6 participated in the study. Students’ MVPA and ST were measured objectively by hip-wo…

MaleeducationPhysical activityphysical activityPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusStructural equation modelingDevelopmental psychologyliikuntataidot03 medical and health sciences0302 clinical medicinekouluikäisetNegatively associatedAccelerometryHumansOrthopedics and Sports MedicineProspective Studies030212 general & internal medicineta315ChildExerciseFinlandfundamental movement skillsSchool educationschool transitionSedentary timeSchools030229 sport sciencesSkill developmentTest (assessment)Motor SkillsExercise TestFemaleSedentary BehaviorPsychologyhuman activitiesThrowingfyysinen aktiivisuusFollow-Up Studies
researchProduct

Recess physical activity and school-related social factors in Finnish primary and lower secondary schools: cross-sectional associations.

2014

Abstract Background Participation in physical activities provides students with opportunities for social interaction and social skills development. The purpose of this study was to investigate the associations of students&#8217; recess physical activity with school-related social factors. Methods Data were collected in 19 schools countrywide in autumn 2010, and 1463 students from grades 4 and 5 (primary school) and from grades 7 and 8 (lower secondary school) completed an anonymous questionnaire. Multiple linear regression analysis was used to investigate whether self-reported physical activity at recess was associated with peer relationships at school, relatedness to school and school clim…

MaleSchoolPediatricsmedicine.medical_specialtyAdolescentCross-sectional studySchool climateeducationMotor ActivityAdolescentsPeer GroupDevelopmental psychologySocial skillsSurveys and QuestionnairesAdaptation PsychologicalmedicineHumansSocial ChangeChildStudentsRecessPeer relationshipsChildrenFinlandSchool Health ServicesSchoolsbusiness.industryPhysical activityPublic healthSocial changePublic Health Environmental and Occupational HealthPeer groupSocial relationTest (assessment)Play and PlaythingsCross-Sectional StudiesSocial factorsFemaleRelatednessBiostatisticsbusinessResearch ArticleBMC public health
researchProduct

Physical activity and obesity mediate the association between childhood motor function and adolescent's academic achievement

2013

The global epidemic of obesity and physical inactivity may have detrimental implications for young people’s cognitive function and academic achievement. This prospective study investigated whether childhood motor function predicts later academic achievement via physical activity, fitness, and obesity. The study sample included 8,061 children from the Northern Finland Birth Cohort 1986, which contains data about parent-reported motor function at age 8 y and self-reported physical activity, predicted cardiorespiratory fitness (cycle ergometer test), obesity (body weight and height), and academic achievement (grades) at age 16 y. Structural equation models with unstandardized (B) and standardi…

GerontologyMaleAdolescentHealth StatusPhysical fitnessAcademic achievementOverweightBody Mass Index03 medical and health sciences0302 clinical medicineSurveys and QuestionnairesmedicineHumans030212 general & internal medicineObesityProspective StudiesChildExerciseMotor skillFinlandta5152. Zero hungerMultidisciplinarybusiness.industryBody WeightCardiorespiratory fitness030229 sport sciencesBiological Sciencesmedicine.diseaseAchievementObesityHealth SurveysConfidence intervalPhysical FitnessMultivariate AnalysisEducational StatusRegression AnalysisFemalemedicine.symptombusinessPsychologyBody mass indexProceedings of the National Academy of Sciences
researchProduct

The Longitudinal Associations of Fitness and Motor Skills with Academic Achievement

2019

Supplemental digital content is available in the text.

GerontologyMaleopintomenestysAdolescentPhysical fitnessMEDLINEPhysical Therapy Sports Therapy and RehabilitationAcademic achievementFUNDAMENTAL MOVEMENT SKILLS03 medical and health sciences0302 clinical medicinekouluikäisetMUSCULAR FITNESSHumansACADEMIC PERFORMANCEOrthopedics and Sports MedicineLongitudinal StudiesChildMuscle Skeletalmotoriset taidotMotor skillFinlandfundamental movement skillsaerobic fitnessAcademic Successbusiness.industry4. EducationFollow up studiesApplied Sciencesacademic performanceCardiorespiratory fitness030229 sport sciencesAEROBIC FITNESSfyysinen kuntomuscular fitnessCardiorespiratory FitnessMotor SkillsPhysical FitnessComputingMethodologies_DOCUMENTANDTEXTPROCESSINGFemaleseurantatutkimusbusinessPsychologyFollow-Up Studies
researchProduct

Changes in Daily Steps and Body Mass Index and Waist to Height Ratio during Four Year Follow-Up in Adults: Cardiovascular Risk in Young Finns Study

2017

Aims: Over the study years, there was a significant increase in body mass index (BMI) and waist-to-height ratio (WtHR) in middle aged Finnish adults. Methods: Data were obtained from 1033 Finnish adults from the Cardiovascular Risk in Young Finns Study in 2007 and 2011. Cohort study participants wore an Omron Walking Style One (HJ-152R-E) pedometer for five days and were grouped into those who increased, maintained and decreased their steps between 2007 and 2011. Paired samples t-test was used to compare body mass index (BMI) and waist-to-height ratio (WtHR) change values between the change groups in study years. Results: Among study population BMI and WtHR increase between study years was …

AdultMalemedicine.medical_specialtyBiolääketieteet - BiomedicineHealth Toxicology and Mutagenesisphysical activitylcsh:Medicinebody mass indexWalking030204 cardiovascular system & hematologywaist-to-height ratioArticle03 medical and health sciences0302 clinical medicinePaired samplesadultsfollow-upHumansMedicine030212 general & internal medicinepainoindeksita315FinlandaskelmittaritaikuisetWaist-to-height ratioWaist-Height Ratiopedometerphysical activity; pedometer; adults; follow-up; body mass index; waist-to-height ratiobusiness.industrylcsh:RSisätaudit - Internal medicinePublic Health Environmental and Occupational HealthFollow up studiesNaisten- ja lastentaudit - Gynaecology and paediatricsMiddle Agedta3121Middle agePedometerPhysical therapyPopulation studyFemalebusinessBody mass indexfyysinen aktiivisuusFollow-Up StudiesCohort studyInternational Journal of Environmental Research and Public Health
researchProduct

Is It Good To Be Good? Dispositional Compassion and Health Behaviors

2018

Background Despite the documented importance of dispositional compassions for a range of health-related outcomes, its role in predicting health behaviors remains unclear. Purpose This study examined the associations between dispositional compassion and three domains of health behavior, including physical activity, alcohol use, and smoking. Methods The participants (N = 1,279–1,913) were from the Finnish population-based Young Finns study. We collected self-reports of compassion in 1997 and 2011 and health behaviors in 2001, 2007, and 2011. In addition, an objective pedometer measure of physical activity was collected in 2011. Linear and logistic regression models were fitted to estimate the…

AdultMaleelintavatanimal structuresAlcohol Drinkingmedia_common.quotation_subjectalcohol consumptionHealth BehaviorPhysical activitycompassionBinge drinkingphysical activityCompassionLogistic regressionBinge Drinking03 medical and health sciencesYoung Adult0302 clinical medicinetupakointiempatiaHumansluonteenpiirteet030212 general & internal medicineLongitudinal StudiesAssociation (psychology)Exerciseta515General PsychologyFinlandmedia_common030505 public healthSmokingta3142Middle AgedExcessive alcohol consumptionhealth behaviorsPsychiatry and Mental healthCross-Sectional StudiesPedometerFemaleHealth behaviorEmpathyalkoholinkäyttö0305 other medical sciencePsychologyfyysinen aktiivisuusClinical psychologyPersonality
researchProduct

Towards a physically more active lifestyle based on one’s own values: the results of a randomized controlled trial among physically inactive adults

2015

Background The high prevalence of physical inactivity has led to a search for novel and feasible interventions that will enhance physical activity, especially among the least physically active individuals. This randomized controlled trial aimed to determine the effectiveness of a value-based intervention to promote a physically more active lifestyle among physically inactive adults. The framework of the study was based on Acceptance and Commitment Therapy (ACT). Methods Physically inactive participants aged 30 to 50 years (n = 138) were randomly allocated to a feedback (FB, n = 69) or an acceptance- and commitment-based group (ACT + FB, n = 69). Both groups received written feedback about t…

AdultMalePhysical activityhyväksymis- ja omistautumisterapiatuloksellisuusAcceptance and commitment therapyPublic Health Environmental and Occupational HealthEffectivenessMiddle AgedACTPsychological well-beingFeedbackSurveys and QuestionnairesPsychotherapy GroupAdultsFeasibility StudiesHumansBehaviourFemaleSelf ReportkäyttäytyminenExerciseLife StyleaikuisetResearch Article
researchProduct

Design and protocol of Estrogenic Regulation of Muscle Apoptosis (ERMA) study with 47 to 55-year-old women's cohort : novel results show menopause-re…

2018

Supplemental Digital Content is available in the text

0301 basic medicineOncologyestradiolivaihdevuodetNeutrophilsBlood count0302 clinical medicineSurveys and QuestionnairesFSHLongitudinal Studiesmenopausal status2. Zero hungerEstradiolvalkosolutApplied MathematicsObstetrics and Gynecologyta3141ta3142Middle AgedMenstruation3. Good health17β-EstradiolMenopauseCohortComputingMethodologies_DOCUMENTANDTEXTPROCESSINGFemaleMenopauselihaskuntoestrogeenitmedicine.medical_specialtyGeneral MathematicsAffect (psychology)Statistics Nonparametric03 medical and health sciencesohjelmoitunut solukuolema17b-Estradiolneutrophil-to-lymphocyte ratioInternal medicinemedicineHumansLymphocyte CountAnalysis of VarianceChi-Square Distributionbusiness.industryOriginal Articlesleucocyte countmedicine.diseaseCross-Sectional Studies030104 developmental biologyApoptosisMultivariate AnalysisLinear Modelsblood viscosityFollicle Stimulating Hormonebusiness030217 neurology & neurosurgeryFollow-Up StudiesHormoneMenopause: The Journal of The North American Menopause Society
researchProduct

Trajectories of Physical Activity Predict the Onset of Depressive Symptoms but Not Their Progression: A Prospective Cohort Study

2016

This prospective, community-based study examined trajectories of physical activity from childhood to adulthood and whether these trajectories contributed to depressive symptoms in adulthood to a greater degree than adulthood physical activity. Participants (n=3596) were from the ongoing Cardiovascular Risk in Young Finns Study which started in 1980. Depressive symptoms were measured with Beck Depression Inventory (BDI-II) in 2012, and physical activity was assessed from 1980 to 2011 with self-reports. Analyses were adjusted for age, sex, childhood negative emotionality, socioeconomic factors, previous depressive symptoms, social support, body mass index, and smoking status (1980–2007). High…

medicine.medical_specialtyLiikuntatiede - Sport and fitness sciencesArticle Subject515 PsychologyeducationPhysical activityphysical activity03 medical and health sciencesSocial support0302 clinical medicinedepressive symptomscohort studyMedicine030212 general & internal medicinelcsh:Sports medicineProspective cohort studyPsychiatryta315Socioeconomic statuskohorttitutkimusDepressive symptomsta5152. Zero hungerBiolääketieteet – Biomedicinebusiness.industryBeck Depression Inventoryta3124030227 psychiatrydepressionSmoking statusbusinesslcsh:RC1200-1245Body mass indexResearch ArticleJournal of Sports Medicine
researchProduct

Physical Activity from Childhood to Adulthood and Cognitive Performance in Midlife

2019

Introduction: Physical activity (PA) has been suggested to protect against old-age cognitive deficits. However, the independent role of childhood/youth PA for adulthood cognitive performance is unknown. This study investigated the association between PA from childhood to adulthood and midlife cognitive performance. Methods: This study is a part of the Cardiovascular Risk in Young Finns Study. Since 1980, a population-based cohort of 3596 children (age, 3–18 yr) have been followed up in 3- to 9-yr intervals. PA has been queried in all study phases. Cumulative PA was determined in childhood (age, 6–12 yr), adolescence (age, 12–18 yr), young adulthood (age, 18–24 yr), and adulthood (age, 24–37…

AdultMalekognitiiviset taidotAdolescentMental abilitylongitudinal researchPhysical activityphysical activityPhysical Therapy Sports Therapy and RehabilitationpitkittäistutkimusNeuropsychological TestsDevelopmental psychologyYoung AdultCognitionAge groupsReaction Timecohort studyHumansAttentionOrthopedics and Sports MedicineLongitudinal StudiesEffects of sleep deprivation on cognitive performanceYoung adultChildta315Exercisecognitive performancekohorttitutkimusFinlandCognitionta3142ta3121Middle Agedta3124Child PreschoolVisual PerceptionFemalePsychologyfyysinen aktiivisuusCohort study
researchProduct

Tracking of physical activity from early childhood through youth into adulthood.

2014

The aim of the study was to investigate the tracking of physical activity (PA) from preschool age to adulthood in six age cohorts of males and females.A random sample of 3596 boys and girls age 3-18 yr participated in the Cardiovascular Risks in Young Finns Study in 1980. The follow-up measurements were repeated in 1986, 1992, 2001, and 2007. The PA was measured by mother's report in 3- and 6-yr-olds and self-report in 9-yr-olds and older. Tracking of PA was analyzed using the Spearman rank-order correlation and a simplex model.Mother-reported PA at age 3 and 6 yr significantly predicted self-reported PA in youth and in young adulthood, and there was a significant indirect effect of mother …

GerontologyMaleAdolescentPhysical activityMEDLINEMothersPhysical Therapy Sports Therapy and RehabilitationMotor ActivityLeisure ActivitiesSex FactorsSex factorsMedicineHumansOrthopedics and Sports MedicineEarly childhoodLongitudinal Studiesta315Self reportExerciseLife StylePreschool childbusiness.industryAge cohortsta3121Child PreschoolFemaleTracking (education)Self ReportbusinessMedicine and science in sports and exercise
researchProduct

Blood and skeletal muscle ageing determined by epigenetic clocks and their associations with physical activity and functioning

2021

AbstractThe aim of this study was to investigate the correspondence of different biological ageing estimates (i.e. epigenetic age) in blood and muscle tissue and their associations with physical activity (PA), physical function and body composition. Two independent cohorts (N = 139 and N = 47) were included, whose age span covered adulthood (23–69 years). Whole blood and m. vastus lateralis samples were collected, and DNA methylation was analysed. Four different DNA methylation age (DNAmAge) estimates were calculated using genome-wide methylation data and publicly available online tools. A novel muscle-specific methylation age was estimated using the R-package ‘MEAT’. PA was measured with q…

EpigenomicsMale0301 basic medicineAgingmaximal oxygen consumptionbiological ageingMonozygotic twinPhysiologyEpigenesis GeneticCohort Studies0302 clinical medicinetwin studyGenetics (clinical)Whole blood0303 health sciencesDNA methylationDual-energy X-ray absorptiometryTwin studyMiddle AgedDNA-metylaatiomedicine.anatomical_structuremuscle massepigenetiikkaDNA methylationFemaledual-energy X-ray absorptiometryAdultMuscle tissueBiologyYoung Adult03 medical and health sciencesMaximal oxygen consumptionmaksimaalinen hapenottoGeneticsmedicineHumansEpigeneticsMuscle SkeletalExerciseMolecular BiologyAged030304 developmental biologykaksostutkimusMuscle strengthResearchSkeletal muscleMuscle massCardiorespiratory fitnessBiological ageingTwin studyikääntyminen030104 developmental biologylihasmassaAgeing3121 General medicine internal medicine and other clinical medicinemuscle strength030217 neurology & neurosurgerylihasvoimaDevelopmental BiologyClinical Epigenetics
researchProduct

Individual- and environmental-related correlates of moderate-to-vigorous physical activity in 11-, 13-, and 15-year-old Finnish children

2020

peer-reviewed The objective of this study was to analyze the associations of various individual- and environmental- related factors with subgroups of daily, frequent, moderate and low moderate-to vigorous physical activity (MVPA) among children and adolescents. Data were obtained from the Finnish School-age Physical Activity (FSPA) study 2016 from 4677 national representative 11-, 13-, and 15-year-old children and adolescents. MVPA and individual- and environmental-related factors were assessed by a questionnaire and analyzed by two-level logistic regression. Seventeen of the twenty-one variables were statistically significantly associated with MVPA. However, only three variables were stati…

MalePhysiologySocial Sciencesphysical activityTransportationliikuntaAdolescentsBody Mass IndexFamiliesSociologyurheilunuoretResidence CharacteristicsSurveys and QuestionnairesMedicine and Health SciencesPsychologyPublic and Occupational HealthadolescentsChildChildrenFinlandSchoolsexerciseQRSports SciencePhysiological ParametersMedicineEngineering and TechnologyFemalesportsfyysinen aktiivisuusResearch ArticleSportsPersonalityvigorousAdolescentScienceeducationlapset (ikäryhmät)schoolsEnvironmentPeer GroupEducationchildrenHumansSports and Exercise MedicineExercisetransportationBehaviorkoulutbehaviorBody WeightBiology and Life SciencesPhysical ActivityCross-Sectional StudiesAge GroupsPhysical FitnessPeople and PlacesRecreationPopulation Groupingshuman activities
researchProduct

Lasten ja nuorten liikunta : Suomen tilannekatsaus 2014 ja kansainvälinen vertailu

2014

nuoretSuomiedistäminenliikuntakansainvälinen vertailulapsetfyysinen aktiivisuus
researchProduct

Continuity and changes in commuting mode and influence on physical activity, BMI and waist circumference among Finnish adults

2022

Regular physical activity (PA) has been found to be important for cardiovascular health and longevity. However, notable proportion of adult population does not meet the national PA recommendations. Active transport is one domain of physical activity, that could be a time-efficient way to increase PA and reach the national recommendations. Additionally, it could have a positive effect to body composition. nonPeerReviewed

BMIactive commutingphysical activityterveyshyödytpainoindeksifyysinen aktiivisuushyötyliikuntaobjective measurementtyömatkat (työpaikalle)
researchProduct

Physical activity, screen time and the incidence of neck and shoulder pain in school-aged children

2022

This study investigated the associations of accelerometer-measured physical activity, sedentary time and screen time with the incidence of neck and shoulder pain in school-aged children over a two-year follow-up. Children (aged 10–15) were measured at baseline 2013 (T0) (n = 970) and at follow-ups 2014 (T1) and 2015 (T2). Neck and shoulder pain frequency and screen time were determined with a web-based questionnaire. Daytime moderate to vigorous physical activity and sedentary time were measured with an accelerometer. Logistic regression was applied, and the results were adjusted for age, gender, body mass index and bedtime. Accelerometer-measured physical activity or sedentary time at base…

istuminenpelaaminenesiintyvyyshartiatniskaruutuaikakipukoululaisetlapset (ikäryhmät)liikuntaverkkopelitfyysinen aktiivisuus
researchProduct

Additional file 1: of Using physical education to promote out-of school physical activity in lower secondary school students â a randomized controlle…

2019

PETALS measures. Measures, data collection time points and methods in the PETALS intervention. Overview of measures, data collection time points and methods in the PETALS intervention including main outcome measure, secondary outcome measure, mediating measures, additional measures, teacher measures, parenting measures and demographic measures. (DOCX 17 kb)

fungi
researchProduct

Co-development of the national monitoring system for the joy of motion, physical activity and motor skills for pre-school-aged children in Finland

2022

In recent years, we have got more information on physical activity and motor skills of preschool-aged children in Finland. However, national monitoring system for this age groups is still lacking in Finland like in many other European countries too. This presentation describes the process and recent results of an on-going research and development project JOYPAM - monitoring the joy of motion, physical activity and motor skills for pre-school-aged children. Aim of the project is to co-create, test and recommend a national level monitoring system by the end of 2020. nonPeerReviewed

varhaiskasvatusesikouluikäisetlapset (ikäryhmät)esikoululaisetliikuntafyysinen hyvinvointifyysinen aktiivisuusco-creation
researchProduct

Clusters of adolescent physical activity tracker patterns and their associations with physical activity behaviors in Finland and Ireland:cross-sectio…

2020

Background:Physical activity trackers (PATs) such as apps and wearable devices (eg, sports watches, heart rate monitors) are increasingly being used by young adolescents. Despite the potential of PATs to help monitor and improve moderate-to-vigorous physical activity (MVPA) behaviors, there is a lack of research that confirms an association between PAT ownership or use and physical activity behaviors at the population level.Objective:The purpose of this study was to examine the ownership and use of PATs in youth and their associations with physical activity behaviors, including daily MVPA, sports club membership, and active travel, in 2 nationally representative samples of young adolescent …

liikuntateknologialcsh:Public aspects of medicineeducationlcsh:RA1-1270varhaisnuoretlcsh:Computer applications to medicine. Medical informaticsactive travelorganised sportfluids and secretionswearableschildrenliikuntatottumuksetmobiilisovelluksetlcsh:R858-859.7self-quantificationactivity trackersliikuntaharrastushuman activitiesfyysinen aktiivisuus
researchProduct

Uusi suositus lapsille ja nuorille : tunti päivässä liikkumista

2021

Uudistunut liikkumissuositus lapsille ja nuorille suosittaa kaikille 7−17-vuotiaille monipuolista, reipasta ja rasittavaa liikkumista vähintään 60 minuuttia päivässä yksilölle sopivalla tavalla, ikä huomioiden. Runsasta ja pitkäkestoista paikallaanoloa tulee välttää. nonPeerReviewed

liikuntakasvatusnuoretkuntoliikuntaliikuntapolitiikkasuosituksetlapset (ikäryhmät)liikuntaliikuntaharrastusfyysinen aktiivisuus
researchProduct

European fitness landscape for children and adolescents: updated reference values, fitness maps and country rankings based on nearly 8 million test r…

2023

Objectives (1) To develop reference values for health-related fitness in European children and adolescents aged 6–18 years that are the foundation for the web-based, open-access and multilanguage fitness platform (FitBack); (2) to provide comparisons across European countries. Methods This study builds on a previous large fitness reference study in European youth by (1) widening the age demographic, (2) identifying the most recent and representative country-level data and (3) including national data from existing fitness surveillance and monitoring systems. We used the Assessing Levels of PHysical Activity and fitness at population level (ALPHA) test battery as it comprises tests with the h…

Settore M-EDF/01 - Metodi e Didattiche delle Attivita' Motorie: Multidisciplinaire généralités & autres [D99] [Sciences de la santé humaine]Physical Therapy Sports Therapy and RehabilitationGeneral Medicineyouth norms physical testingphysical fitness; children; adolescent; europe;Athletic & outdoor sports & gameschildrenadolescentMedicine and Health Sciencesphysical fitnessOrthopedics and Sports Medicineddc:796europephysical endurance: Multidisciplinary general & others [D99] [Human health sciences]
researchProduct

Using physical education to promote out-of school physical activity in lower secondary school students : a randomized controlled trial protocol

2019

Background Given the documented decline in levels of physical activity in early adolescence, promoting physical activity in young people is a priority for health promotion. School physical education (PE) is an important existing network in which participation in physical activity beyond school can be promoted to the captive young people. The objective of current article is to present the protocol for a PE teacher-delivered theory-based trial to promote secondary school students’ participation in physical activity out-of-school contexts. The intervention will be guided by the trans-contextual model explaining the processes by which PE teachers’ support for autonomous motivation in the classr…

Maleand promotion of well-beingkoululaisetSELF-DETERMINATION-THEORYliikuntaCardiovascularStudy ProtocolkoululiikuntaIMPLEMENTATIONTrans-contextual modelSCALEAutonomy supportPediatricmotivaatioPhysical Education and TrainingSchoolsIntervention developmentPERCEIVED AUTONOMY SUPPORTlcsh:Public aspects of medicineENGAGEMENTSelf-determination theoryliikuntakasvatus5144 Social psychologyautonomy supportPublic Health and Health ServicesFemalePublic HealthHEALTH BEHAVIOR-CHANGEINTERVENTIONfyysinen aktiivisuusINTRINSIC MOTIVATIONAdolescentself-determination theorytheory of planned behaviourClinical Trials and Supportive ActivitieseducationTheory of planned behaviourHealth Promotionintervention developmentbehavioural interventionClinical ResearchBehavioral and Social ScienceTEACHERHumansStudentsExerciseMotivationBehavioural interventiontrans-contextual modelPreventionlcsh:RA1-1270Prevention of disease and conditionsCOMPETENCEQuality Educationterveyskäyttäytyminen3.1 Primary prevention interventions to modify behaviours or promote wellbeing
researchProduct

Yläkoululaisten subjektiivisen sosiaalisen aseman yhteys välituntiliikuntaan ja osallisuuteen

2014

school hierarchysubjective social statusrecessnuoretphysical activitieskouluhierarkiasecondary schoolosallisuusadolescentsyläkouluvälituntiliikuntasubjektiivinen sosiaalinen asemaosallistuminen
researchProduct

LASERI-seurantatutkimus: Liikunta-aktiivisuus lapsuudesta aikuisuuteen ja sen yhteydet muihin elintapoihin

2018

LASERI-tutkimuksessa kartoitetaan nyt, miten liikunta-aktiivisuus elämän eri vaiheissa on yhteydessä muihin elintapoihin. Voisiko liikuntaaktiivisuuden lisääntyminen olla reitti esimerkiksi parempiin ravintotottumuksiin tai vähäisempään tupakointiin? nonPeerReviewed

ruokatottumuksetelintavataikuisuustupakointilapsuusliikuntaalkoholinkäyttökehityspolkuanalyysielämänkaariterveellisyysvapaa-aikaterveyden edistäminen
researchProduct

Long-term determinants of changes in television viewing time in adults : Prospective analyses from the Young Finns Study

2018

Purpose: The long‐term effects of sociodemographic and health characteristics on television viewing (TV) time changes have not been identified in adulthood. We aimed to examine the modifiable and non‐modifiable determinants of changes in TV‐time in young adults over 10 years.Methods: Participants (N = 2929) aged 24‐39 years were recruited between 2001 and 2011 from the Cardiovascular Risk in Young Finns Study. Data were collected using questionnaires and a medical examination. The determinants of changes in TV‐time were estimated using latent growth modeling for men and women separately.Results: For men, inverse associations with initial levels of TV‐time were observed for students becoming…

TV-timelatent growth modelingaikuisuusdeterminantitlongitudinalajankäyttötelevisio (joukkoviestimet)pitkittäistutkimuskatselutottumuksettaustatekijät
researchProduct

Lasten ja nuorten liikuntakäyttäytyminen Suomessa : LIITU-tutkimuksen tuloksia 2018

2019

nuoretkoululiikuntaterveyskäyttäytyminenliikuntatottumuksetlapset (ikäryhmät)liikuntaliikuntaharrastusfyysinen aktiivisuus
researchProduct

Lasten liikkuminen kylmässä ja kuumassa : lämmönsäätelyn erityispiirteitä

2018

Lapset eroavat paitsi fysiologialtaan, myös käyttäytymiseltään aikuisista. Lasten lämmönsäätelyn erityispiirteet tulee huomioida, jotta he voivat nauttia liikkumisesta, harjoitella ja kilpailla eri lajeissa vaihtelevissa sääolosuhteissa turvallisesti ja toimintakykynsä säilyttäen. nonPeerReviewed

childrentoimintakykyolosuhteetterveysvaikutuksetphysical activityulkoliikuntalapset (ikäryhmät)liikuntalämmönsäätelyfyysinen aktiivisuus
researchProduct

Nuorten liikuntakäyttäytyminen Suomessa : LIITU-tutkimuksen tuloksia 2020

2021

motivaatiopenkkiurheilupelaaminenvideopelitsosiaalinen tukikilpaurheiluterveysosaaminenliikuntaerityisliikuntaliikuntavammat (liikunnassa syntyneet)arvot (käsitykset)koululiikuntanuoretterveyskäyttäytyminenkiusaaminenliikuntaharrastusfyysinen aktiivisuus
researchProduct

Finnish report card 2014 on physical activity for children and youth

2014

motivaatioliikuntakasvatusnuorettutkimusohjelmatfyysinen aktiivisuuslapsetviihtyisyys
researchProduct

Keski-ikäinen tarvitsee lisää askeleita arkeensa

2017

Harrastamme enemmän liikuntaa, mutta lihomme siitä huolimatta. Kehitys on samansuuntaista kaikkialla länsimaissa. Keski-iässä tarvitaankin lisää askeleita arkeen, jotta painonnousu pysyy kurissa. nonPeerReviewed

liikuntakeski-ikäisetterveyshyötyliikuntakävely
researchProduct

Kolmevuotiaiden päiväkotilasten mitattu fyysinen aktiivisuus

2012

Tämän tutkimuksen tarkoituksena oli selvittää kolmevuotiaiden lasten fyysisen aktiivisuuden määrä ja intensiteetti sekä selvittää täyttyvätkö alle kouluikäisten Varhaiskasvatuksen liikunnan suositukset (2005) kahden tunnin reippaasta päivittäisestä liikunnasta tutkimukseen osallistuvilla lapsilla. Tutkimuksessa vertailtiin myös poikien ja tyttöjen sekä arki- ja viikonlopun päivien välisiä eroja. Aineisto kerättiin 14 vapaaehtoisesta päiväkodista elokuusta lokakuuhun 2010. Lasten fyysinen aktiivisuus mitattiin ActiGraph GT3Xkiihtyvyysmittareilla viiden peräkkäisen päivän ajan. Hyväksyttävä aineisto, vähintään kahdeksan tuntia mittausta kolmena arkipäivänä ja yhtenä viikonlopun päivänä, saati…

päiväkoti-ikäiset lapsetaccelerometerpreschool aged childrenchildcare centrekotiphysical activitypäiväkotikiihtyvyysmittarifyysinen aktiivisuus
researchProduct

Training programme for novice physical activity instructors using Teaching Personal and Social Responsibility (TPSR) model : a programme development …

2021

Previous research indicates that programmes employing Hellison?s Teaching Personal and Social Responsibility (TPSR) model in physical activity have had a positive impact on youth development by increasing participants? positive values, autonomy, life skills, and prosocial behaviour. Despite encouraging results of the effects of TPSR-based programmes, there remains lack of research on the effective content of these programmes, and their implementation and evaluation. The current protocol article describes the development of a TPSR-based instructor training programme and a plan for an intervention study in which novice instructors learn to understand and apply the TPSR model in practice. The …

INTRINSIC MOTIVATIONAFTER-SCHOOL PROGRAMliikunnanohjaajatvastuuntuntoTPSR-malliTEACHERSnovice physical activity instructorsliikuntaSPORTCLUBurheiluIMPLEMENTATIONComputingMilieux_COMPUTERSANDEDUCATIONharjoittelu315 Sport and fitness sciencesopettajankoulutuspositive youth developmentVALUEStuloksetEDUCATIONinterventiotutkimusTPSR modelphysical activity instructor training programmeprotocol for a covariate adaptive randomised controlled studyPROFESSIONAL-DEVELOPMENT5144 Social psychologyTeaching Personal and Social Responsibility -mallivastuuntuntoisuuden mallithe TPSR model516 Educational scienceskehitysPOSITIVE YOUTH DEVELOPMENTliikunnanopettajatfyysinen aktiivisuus
researchProduct

Liikunnan ja oppimisen vuorovaikutusta kartoittamassa

2017

Oppiminen on laaja kokonaisuus ja liikunta tärkeä kasvuympäristön tarjoama oppimisväylä. Liikuntatutkimus on avannut uusia näkymiä liikunnan ja oppimisen yhteyksiin. Liikunnan myönteiset vaikutukset kouluarvosanoihin on havaittu erityisesti matemaattisissa aineissa. Liikunta voi myös vahvistaa lasten muistia ja toiminnanohjausta. Motoristen taitojen hallitseminen puolestaan vaikuttaa myös aivojen kehittymiseen. nonPeerReviewed

kartoitusvuorovaikutusoppiminenliikunta
researchProduct

Promoting physical activity in Finnish early childhood education and care, and the implementation of national recommendations of physical activity fo…

2022

Joy in Motion is a nationwide physical activity and well-being programme aimed at early childhood education and care (ECEC) launched in 2015 in Finland. The aim is to enable every child to be physically active and enjoy physical activity every day. Latest updates of the Finnish recommendations for physical activity in early childhood was published in 2016. The key message in the recommendations is Joy, play and doing together. Daily physical activity is just as important for children's well-being as healthy nutrition and sufficient sleep and rest. Presentations discuss the current state of the programme with more than 2200 registered early education units and provides concrete examples of t…

varhaiskasvatuschildrenesikouluikäisetpreschool-agedprogrammelapset (ikäryhmät)esikoululaisetliikuntafyysinen hyvinvointifyysinen aktiivisuus
researchProduct

Does organized sport participation during youth predict healthy habits in adulthood? : A 28-year longitudinal study

2018

Health behaviors in youth can predict the same behaviors later in life, but the role of sport participation in predicting healthy lifestyle habits is unclear. This study aimed to investigate the association between participation in organized youth sport and adult healthy lifestyle habits. Data from the longitudinal Cardiovascular Risk in Young Finns Study (YFS) with a 28‐year follow‐up were used. The participation in sport‐club training sessions was self‐reported by 9‐18‐year‐olds in 1983 and 1986 (n = 1285). During 2011, participants (aged 37‐43‐year old) reported their smoking status, alcohol consumption, fruit and vegetable consumption, and physical activity. Odd ratios (OR) were calcula…

health behaviorselintavataikuisuuslongitudinalterveyskäyttäytyminenphysical activitynuoruuspitkittäistutkimussportliikuntaharrastusfyysinen aktiivisuus
researchProduct

Physical Inactivity from Youth to Adulthood and Risk of Impaired Glucose Metabolism

2018

INTRODUCTION: Physical activity (PA) is important in the prevention and treatment of impaired glucose metabolism. However, association of physical inactivity during the transition between childhood and adulthood with glucose metabolism is unknown. Therefore, we studied the association of persistent physical inactivity since childhood with glucose metabolism in adulthood. METHODS: Data were drawn from the ongoing, Cardiovascular Risk in Young Finns Study with repeated follow-ups between 1980 and 2011 (baseline age, 3-18 yr; n = 3596). Impaired glucose metabolism was defined as having impaired fasting glucose (6.1-6.9 mmol·L) or type 2 diabetes in adulthood. Leisure-time PA habits were repeat…

aikuisuusaineenvaihduntahäiriötphysical inactivityphysical activityliikkumattomuuspitkittäistutkimuslapsuusimpaired glucose metabolismaikuistyypin diabetesfyysinen aktiivisuus
researchProduct

Menopausal Status and Physical Activity Are Independently Associated With Cardiovascular Risk Factors of Healthy Middle-Aged Women: Cross-Sectional a…

2019

Cardiovascular disease (CVD) is the primary cause of mortality in women in developed countries. CVD risk rises with age, yet for women there is a rapid increase in CVD risk that occurs after the onset of menopause. This observation suggests the presence of factors in the middle-aged women that accelerate the progression of CVD independent of chronological aging. Leisure time physical activity (LTPA) is a well-established protective factor against CVD. However, its role in attenuating atherogenic lipid profile changes and CVD risk in post-menopausal women has not been well-established. The present study is part of the Estrogenic Regulation of Muscle Apoptosis (ERMA) study, a population-based…

lcsh:RC648-665vaihdevuodetHDLkolesterolimenopausephysical activitycholesteroltriglyseriditHDL-kolesterolilcsh:Diseases of the endocrine glands. Clinical endocrinologyLDLEndocrinologycardiovascular diseasesydän- ja verisuonitauditfasting blood glucoseLDL-kolesterolitriglyceridesfyysinen aktiivisuusOriginal ResearchFrontiers in Endocrinology
researchProduct

The association of childhood commuting modes and physical activity in adult age

2022

Background Physically active lifestyle prevents and contributes to managing non-communicable diseases. Childhood physical activities have shown to associate with physically active lifestyle in adulthood. More research on which childhood physical activity modes associate with physical activity in later life is still needed. Within the present study, we examined how physically active commuting to school in childhood contributed to overall physical activity in adulhood. Methods The participants (N = 3596) were from the population-based, longitudinal Cardiovascular Risks in Young Finns Study. Questionnaires were used in assessing subjects' childhood (1980) and adulthood (2001-2018) physical act…

active commutinglongitudinal studyaccelometer-measured physical activitypitkittäistutkimusliikuntaself-reported physical activityfyysinen aktiivisuustyömatkat (työpaikalle)
researchProduct

Design and protocol of Estrogenic Regulation of Muscle Apoptosis (ERMA) study with 47 to 55-year-old women's cohort : novel results show menopause-re…

2018

Objective: The multidisciplinary Estrogenic Regulation of Muscle Apoptosis (ERMA) study was designed to reveal how hormonal differences over the menopausal stages affect the physiological and psychological functioning of middle-aged women. This paper describes the protocol and nonrespondent analysis of ERMA and novel findings on menopausal differences in blood count variables and their association with female sex hormones. Methods: Women aged 47 to 55 years were assigned to pre, early peri, late peri, and postmenopausal groups based on follicle-stimulating hormone (FSH) and bleeding diary. Multivariate linear regression models were constructed to estimate the association of 17b-estradiol (E…

estrogeenit17b-Estradiolestradioliohjelmoitunut solukuolemavalkosolutvaihdevuodetneutrophil-to-lymphocyte ratioFSHblood viscosityleucocyte countlihaskuntomenopausal status
researchProduct