0000000000327006

AUTHOR

Laura Vesala

showing 10 related works from this author

Myo-inositol as a main metabolite in overwintering flies: seasonal metabolomic profiles and cold stress tolerance in a northern drosophilid fly

2012

SUMMARY Coping with seasonal changes in temperature is an important factor underlying the ability of insects to survive over the harsh winter conditions in the northern temperate zone, and only a few drosophilids have been able to colonize sub-polar habitats. Information on their winter physiology is needed as it may shed light on the adaptive mechanisms of overwintering when compared with abundant data on the thermal physiology of more southern species, such as Drosophila melanogaster. Here we report the first seasonal metabolite analysis in a Drosophila species. We traced changes in the cold tolerance and metabolomic profiles in adult Drosophila montana flies that were exposed to thermope…

MalePhysiologyClimatekylmäkoomasta toipuminenvuodenaikaisuuschemistry.chemical_compoundkylmänkestävyyskylmään sopeutuminenFinlandOverwinteringphotoperiodismPrincipal Component Analysisbiologyseasonalitycryoprotectantcold acclimationTemperatureAdaptation PhysiologicalCold TemperatureHabitatMetabolomeDrosophilaFemaleSeasonsDrosophila melanogasterProlinePhotoperiodchill coma recoveryreproductive diapauseAquatic ScienceStress PhysiologicalBotanyTemperate climatemedicineCold acclimationAnimalsMetabolomicsHistidineLactic AcidMolecular BiologyEcology Evolution Behavior and Systematicsfungicold toleranceSeasonalitybiology.organism_classificationmedicine.diseaseTrehalosekryoprotektantitchemistrylisääntymisdiapaussiInsect Scienceta1181Animal Science and ZoologyInositol
researchProduct

Effects of photoperiodically induced reproductive diapause and cold hardening on the cold tolerance of Drosophila montana

2010

Coping with seasonal and daily variation in environmental conditions requires that organisms are able to adjust their reproduction and stress tolerance according to environmental conditions. Females of Drosophila montana populations have adapted to survive over the dark and cold winters at high latitudes and altitudes by spending this season in photoperiodically controlled reproductive diapause and reproducing only in spring/summer. The present study showed that flies of a northern population of this species are quite tolerant of low temperatures and show high seasonal and short-term plasticity in this trait. Culturing the flies in short day length (nearly all females in reproductive diapau…

MaleLightPhysiologyCold tolerancePhotoperiodPopulationZoologyCold treatmentDiapauseBiologymedicineAnimalsDay lengtheducationDrosophila montanaeducation.field_of_studyEcologyReproductionfungiSeasonalitymedicine.diseaseCold TemperatureDrosophila melanogasterInsect ScienceFemaleCold hardeningJournal of Insect Physiology
researchProduct

Changes in gene expression linked with adult reproductive diapause in a northern malt fly species: a candidate gene microarray study

2010

Abstract Background Insect diapause is an important biological process which involves many life-history parameters important for survival and reproductive fitness at both individual and population level. Drosophila montana, a species of D. virilis group, has a profound photoperiodic reproductive diapause that enables the adult flies to survive through the harsh winter conditions of high latitudes and altitudes. We created a custom-made microarray for D. montana with 101 genes known to affect traits important in diapause, photoperiodism, reproductive behaviour, circadian clock and stress tolerance in model Drosophila species. This array gave us a chance to filter out genes showing expression…

Candidate geneMicroarrayPhotoperiodCircadian clockDown-RegulationGenes InsectBiologyDiapauseEnvironmental Science(all)Research articleAnimalsDrosophilaEcology Evolution Behavior and SystematicsQH540-549.5Oligonucleotide Array Sequence AnalysisGeneral Environmental SciencephotoperiodismReproductive successEcologyReverse Transcriptase Polymerase Chain ReactionEcologyGene Expression ProfilingReproductionfungiGene Expression Regulation Developmentalbiology.organism_classificationUp-RegulationGene expression profilingDrosophilaFemaleBMC Ecology
researchProduct

Photoperiodic regulation of life-history traits before and after eclosion: egg-to-adult development time, juvenile body weight and reproductive diapa…

2012

Photoperiod is the main environmental cue used by northern insects to predict the forthcoming seasonal changes and to adjust their life-history traits to fit these changes. We studied the effects of photoperiod on egg-to-adult development time, juvenile body mass and female reproductive diapause in two northern Drosophila montana populations with different patterns of voltinism. The most interesting findings were consistent between the populations: (1) when maintained before eclosion in short day conditions, representing early autumn, the flies developed faster and were lighter than when maintained in long day conditions, representing early summer, (2) photoperiodic time measurement is appa…

photoperiodismMaleendocrine systemLarvabiologyPhysiologyEcologyPeriod (gene)PhotoperiodReproductionVoltinismBody WeightOvaryDiapausebiology.organism_classificationLife history theoryInsect ScienceLarvaJuvenileAnimalsta1181DrosophilaFemaleDrosophilaJournal of Insect Physiology
researchProduct

How consistent are the transcriptome changes associated with cold acclimation in two species of the Drosophila virilis group?

2015

This work was financially support by a Marie Curie Initial Training Network grant, “Understanding the evolutionary origin of biological diversity” (ITN-2008–213780 SPECIATION), grants from the Academy of Finland to A.H. (project 132619) and M.K. (projects 268214 and 272927), a grant from NERC, UK to M.G.R. (grant NE/J020818/1), and NERC, UK PhD studentship to D.J.P. (NE/I528634/1). For many organisms the ability to cold acclimate with the onset of seasonal cold has major implications for their fitness. In insects, where this ability is widespread, the physiological changes associated with increased cold tolerance have been well studied. Despite this, little work has been done to trace chang…

Chill-comaAcclimatizationQH301 BiologyDrosophila virilisStress toleranceGenes Insectta3111AcclimatizationTranscriptomeMyoinositolQH301Species SpecificityCulex-pipiensMelanogasterGeneticsMelanogasterCold acclimationAnimalsThermotaxisCircadian rhythmDifferential expression analysisGeneGenetics (clinical)Northern house mosquitoGeneticsbiologySequence Analysis RNAcold acclimationta1184TemperatureChromosome MappingLarge gene listsbiology.organism_classificationBiological-membranesCold TemperatureDrosophila virilisMultigene Familyta1181Original ArticleDrosophilaFemaleGenetic FitnessTranscriptomeHeredity
researchProduct

Seasonal gene expression kinetics between diapause phases in Drosophila virilis group species and overwintering differences between diapausing and no…

2015

AbstractMost northern insect species experience a period of developmental arrest, diapause, which enables them to survive over the winter and postpone reproduction until favorable conditions. We studied the timing of reproductive diapause and its long-term effects on the cold tolerance of Drosophila montana, D. littoralis and D. ezoana females in seasonally varying environmental conditions. At the same time we traced expression levels of 219 genes in D. montana using a custom-made microarray. We show that the seasonal switch to reproductive diapause occurs over a short time period and that overwintering in reproductive diapause has long-lasting effects on cold tolerance. Some genes, such as…

Period (gene)media_common.quotation_subjectPhotoperiodAdaptation BiologicalZoologyInsectDiapauseDiapause InsectArticleGenetiikka kehitysbiologia fysiologia - Genetics developmental biology physiologyLääketieteen bioteknologia - Medical biotechnologyBotanyAnimalsgeeniekspressioOverwinteringmedia_commonphotoperiodismMultidisciplinarybiologyta1184ReproductionTemperatureEcological geneticsbiology.organism_classificationDrosophila virilisGene Expression Regulationta1181DrosophilaFemaleGene expressionSeasonsAdaptationReproductionTranscriptionScientific reports
researchProduct

Cold tolerance and cold-induced modulation of gene expression in two Drosophila virilis group species with different distributions

2011

Abstract The importance of high and low temperature tolerance in adaptation to changing environmental conditions has evoked new interest in modulations in gene expression and metabolism linked with stress tolerance. We investigated the effects of rapid cold hardening and cold acclimatization on the chill coma recovery times of two Drosophila virilis group species, Drosophila montana and D. virilis, with different distributions and utilized a candidate gene approach to trace changes in their gene expression during and after the cold treatments. The study showed that cold acclimatization clearly decreases chill coma recovery times in both species, whereas rapid cold hardening did not have a s…

GeneticsCandidate geneMicroarray analysis techniquesBiologybiology.organism_classificationAcclimatizationDrosophila virilisInsect ScienceGene expressionGeneticssense organsHeat shockCold hardeningMolecular BiologyGeneInsect Molecular Biology
researchProduct

Photoperiodic regulation of cold tolerance and expression levels of regucalcin gene in Drosophila montana

2011

Temperature-induced plasticity of cold tolerance has been reported in many insect species, but cold tolerance can also be affected by changes in day (or night) length. In the present study we elucidate the direct and indirect effects of photoperiod on the cold tolerance of females of two Drosophila montana strains--one which possesses a robust photoperiodic diapause and another which does not. In the diapause-strain the time needed for recovery from chill coma showed a positive correlation with day length, but diapause itself played only a minor role in photoperiodic acclimation. The strain that was not able to enter to diapause as a response to day length also lacked photoperiodic cold acc…

Maleendocrine systemPhysiologyPhotoperiodmedia_common.quotation_subjectInsectDiapauseBiologyAcclimatizationBotanyCold acclimationAnimalsDrosophila ProteinsGenemedia_commonphotoperiodismReproductionCalcium-Binding ProteinsIntracellular Signaling Peptides and Proteinsfood and beveragesRegucalcinAdaptation PhysiologicalCell biologyCold TemperatureInsect ScienceDrosophilaFemaleAdaptationJournal of Insect Physiology
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Changes in gene expression linked with adult reproductive diapause in a northern malt fly species: a candidate gene microarray study

2010

Background: Insect diapause is an important biological process which involves many life-history parameters important for survival and reproductive fitness at both individual and population level. Drosophila montana, a species of D. virilis group, has a profound photoperiodic reproductive diapause that enables the adult flies to survive through the harsh winter conditions of high latitudes and altitudes. We created a custom-made microarray for D. montana with 101 genes known to affect traits important in diapause, photoperiodism, reproductive behaviour, circadian clock and stress tolerance in model Drosophila species. This array gave us a chance to filter out genes showing expression changes…

geenitgene expressionreproductive diapausemikrosirulisääntymislepotilamicroarray
researchProduct