Search results for " Gain"

showing 10 items of 308 documents

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct

Bone mineral metabolism in the micropremie

2000

Environmental factors, nutritional supplies, hormonal status, diseases, and treatments appear to affect postnatal skeletal growth and mineralization in VLBW infants. Compared with their term counterparts, ELBW infants are at risk of postnatal growth deficiency and osteopenia at the time of hospital discharge. From recent data, DXA is becoming one of the reference techniques to evaluate mineral status, whole-body composition, and effects of dietary manipulations on weight gain composition and mineral accretion in preterm infants. Weight gain and length increases need to be evaluated carefully during the first weeks of life, in the intensive care unit and out of it, in the step down unit. Nut…

Peak bone massParenteral NutritionPediatricsmedicine.medical_specialtyBone mineral metabolismWeight Gainlaw.inventionCalcification PhysiologicEnteral NutritionlawInternal medicinemedicineHumansInfant Very Low Birth WeightInfant Nutritional Physiological PhenomenaInfant Nutritional Physiological PhenomenaMineralsBone Developmentbusiness.industryInfant NewbornObstetrics and Gynecologymedicine.diseaseIntensive care unitOsteopeniaEndocrinologyParenteral nutritionPediatrics Perinatology and Child Healthmedicine.symptomLinear growthbusinessWeight gainInfant Premature
researchProduct

Nutritional assessment in preterm infants with special reference to body composition

2001

In recent years, improvements in care have significantly improved survival in preterm and, particularily, the very low birth weight infant (VLBW). While immediate survival can be directly related to pulmonary maturity, several studies stress the importance of timely and adequate nutrition in these high-risk infants on a short- and long-term [1]. Yet, nutritional support remains a very controversial issue in these high-risk infants. Early provision of adequate intakes may be limited by clinical instability and immaturity. At the same time, nutritional requirements and methods of nutritional assessment are not well defined. The aim of this paper is to outline some of the methods used during n…

Pediatricsmedicine.medical_specialtybusiness.industryBody WeightInfant NewbornImproved survivalBody HeightSkinfold ThicknessLow birth weightAbsorptiometry PhotonNutrition AssessmentAnimals NewbornBone DensityPediatrics Perinatology and Child HealthBody CompositionmedicineAnimalsHumansmedicine.symptomEnergy MetabolismInfant Nutritional Physiological PhenomenabusinessWeight gainInfant PrematureSeminars in Neonatology
researchProduct

Some Outcomes of Pressure, Ingratiation, and Rational Persuasion Used With Peers in the Workplace1

2003

In a cross-sectional organizational field study, the effects of ingratiation, pressure, and rational persuasion on performance appraisal, compliance gaining, and reactance were investigated. Actors were asked to describe their lateral-influence strategies, and peers were asked to assess actors’ impact. Actors and assessors from 140 German lateral-influence dyads who were public officeholders and employees participated in the study. The data support the hypothesis that the more an actor uses rational persuasion and the longer the assessor has known the actor, the more positively the assessor will evaluate the actor's task performance. In addition, the results support the hypothesis that the …

Performance appraisalPersuasionSocial Psychologymedia_common.quotation_subjectReactanceCompliance gaininglanguage.human_languageTask (project management)GermanIngratiationlanguagePsychologyOrganizational fieldSocial psychologymedia_commonJournal of Applied Social Psychology
researchProduct

Effects of nonlinearity and substrate’s deformability on modulation instability in NKG equation

2017

International audience; This article investigates combined effects of nonlinearities and substrate's deformability on modulational instability. For that, we consider a lattice model based on the nonlinear Klein-Gordon equation with an on-site potential of deformable shape. Such a consideration enables to broaden the description of energy-localization mechanisms in various physical systems. We consider the strong-coupling limit and employ semi-discrete approximation to show that nonlinear wave modulations can be described by an extended nonlinear Schrodinger equation containing a fourth-order dispersion component. The stability of modulation of carrier waves is scrutinized and the following …

Physical systemModulational instability01 natural sciencesInstability010309 opticssymbols.namesakeDeformable lattice0103 physical sciencesNumerical simulations[MATH]Mathematics [math]010306 general physicsDispersion (water waves)PropagationNonlinear Schrödinger equationPhysics[PHYS]Physics [physics]Numerical AnalysisApplied MathematicsMathematical analysisInstability domains and gains[PHYS.MECA]Physics [physics]/Mechanics [physics]DispersionNonlinear systemModulational instabilityAmplitudeClassical mechanicsModeling and SimulationExtended nonlinear SchrodingersymbolsLattice model (physics)
researchProduct

Multi-longitudinal mode emission in a bidirectional laser model

2011

Multi-longitudinal mode emission is a fundamental issue in laser physics. Interestingly enough, the mechanisms responsible for the transition from single- to multi-longitudinal mode emission have not been completely clarified yet. For example, it is well known that in unidirectional ring lasers the Rabi splitting of the lasing transition can lead to multimode emission even in a homogeneously broadened medium, the so called Risken-Nummedal—Graham-Haken instability (RNGHI) [1]. In spite of being known since the late sixties, only in the recent years a couple of experiments have demonstrated “dressed” versions of the RNGHI [2], i.e., up to day there are not clear demonstrations of this basic m…

PhysicsActive laser mediumbusiness.industryLaser scienceLaser pumpingInjection seederLaserlaw.inventionOpticslawQuantum electrodynamicsSemiconductor optical gainbusinessLasing thresholdTunable laser
researchProduct

Stabilisation of dispersion-managed soliton transmissions by nonlinear gain

1999

Nonlinear gain is shown to be effective in suppressing the radiative background that may not be separated from the signal when the average dispersion is close to zero in dispersion-managed soliton transmissions. By correctly combining nonlinear gain and filtering, the instability introduced by guiding filters can be avoided.

PhysicsControl theoryNonlinear gainDispersion (optics)Radiative transferDispersion managedSoliton (optics)Electrical and Electronic EngineeringSignalInstabilityElectronics Letters
researchProduct

Comprehensive Theoretical and Experimental Study of Short- and Long-Term Stability in a Passively Mode-Locked Solitonic Fiber Laser

2015

We demonstrate the short- and long-term stable operation of an all-polarization-maintained Fabry–Perot cavity passively mode-locked fiber laser. The laser operates in an all-anomalous-dispersion solitonic regime. Laser stability is studied by a variety of measurements, which confirm the high stability of the laser in the temporal and spectral–both optical and electrical-domains. Pulse durations of 540 fs, period-relative time jitters of $\sim$ 0.015‰, and long-term uninterrumped operation with 0.4% variation (standard deviation) in the average output power are obtained. The highly stable operation of the laser oscillator was maintained after amplifying the laser output with a conventional E…

PhysicsDistributed feedback laserActive laser mediumbusiness.industryPhysics::OpticsInjection seederLaserAtomic and Molecular Physics and OpticsSelf-pulsationlaw.inventionRound-trip gainOpticslawFiber laserLaser power scalingbusiness
researchProduct

THE QUANTITATIVE RECORDING OF SEISMIC EVENTS WITH EXTREMELY LARGE AMPLITUDE VARIATIONS BY DISCONTINUOUS GAIN CONTROL*

1963

A transistorized combination of multivibrators is described, by which the gain is set according to a time programme. This equipment allows quantitative recording of seismic events with extremely large amplitude variations. Some possible applications of this recording system to seismic research are discussed. ZUSAMMENFASSUNG Es wird eine transistorisierte Zeitschalterkombination beschrieben, die zur Einstellung vorgewahlter Verstarkungsstufen nach Zeitprogramm dient. Mit dieser Anordnung lassen sich seismische Vorgange mit beliebigen Amplituden-Anderungen quantitativ erfassen. Es werden einige Beispiele der seismischen Forschung diskutiert, bei denen diese Regis-triertechnik erfolgreich eing…

PhysicsGeophysicsAmplitudeGeochemistry and PetrologyAcousticsAutomatic gain controlGeophysical Prospecting
researchProduct

Design of a Compact Dual Circular-Polarized Antenna for L-Band Satellite Applications

2020

In this paper, we propose the design of a dual circular-polarized antenna for L-band applications (1.1-1.6 GHz). The designed antenna has been developed by considering crossed-dipoles on top of which a circular patch has been placed to properly act on the mutual coupling between the dipoles. The dual circular polarization is achieved by feeding dipoles in quadrature. Moreover, to increase the antenna gain and polarization purity at high elevation angles, a fence of passive monopoles has been added. The proposed antenna can profitably used as primary feed of a low-frequency parabolic reflector.

PhysicsL bandbusiness.industryParabolic reflectorBandwidth (signal processing)Astrophysics::Instrumentation and Methods for Astrophysics020206 networking & telecommunicationsCircular polarization crossed dipoles patch antennas small satellites02 engineering and technologyPolarization (waves)Settore ING-INF/01 - Elettronicalaw.inventionSettore ING-IND/31 - ElettrotecnicaDipoleOpticslaw0202 electrical engineering electronic engineering information engineeringDipole antennaElectrical and Electronic EngineeringAntenna gainbusinessCircular polarizationIEEE Antennas and Wireless Propagation Letters
researchProduct