Search results for " Housing"

showing 10 items of 141 documents

Conceptualisation et évaluation d'une typologie de lotissement vertical pour un aménagement urbain durable

2020

The current urban development process is the result of a paradoxical situation. On the one end, families prefer individual housing, which finds the favourable conditions to its spreading in the more or less distant from towns outskirts, while wishing to benefit from services (proximity to amenities, public transport offers, etc…) which are rather the corelate of dense urban centralization. On the other hand, in order to fight against environmental, social and economic costs of urban sprawl, and also aim towards a more sustainable city, the urban renovation and compact city projects lead to some density levels that only collective housing enables to reach. So, the equation - control of the u…

Ville durableTypologie d'habitat[SHS.GEO] Humanities and Social Sciences/GeographyUrban renewalLotissement vertical[SHS.GEO]Humanities and Social Sciences/GeographyForme urbaineUrban formVertical housing projectSustainable cityHousing typologyRenouvellement urbainCompact cityVille compacte
researchProduct

Les agglomérations antiques du Val de Saône : émergence et mutations d’un réseau urbain de la fin de l’âge du Fer au début du Moyen Âge

2019

The aim of this thesis is to study the processes of emergence, structuring and mutation of an ancient urban network from the end of the Protohistory to the beginning of the Middle Ages in a micro-region located on the edge of the ancient éduens, lingons and séquanes territories, the Saône Valley. This area is characterized by a density of Gallo-Roman small towns with an amount and a high quality of data unequalled in Gaul, as a result of ancient and recent research. While these small towns were among the first studied in the 1980’s, their exploitation was limited to the study of hierarchies and urban functions during the High Empire, neglecting the chronology and the evolution of the urban …

[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and PrehistoryBourgogne-Franche-ComtéSaône Valleyurban networkréseau urbainancient small townhabitat groupéVal de Saôneagglomération antiquegrouped housing
researchProduct

Exploring Associations of Housing, Relocation, and Active and Healthy Aging in Sweden : Protocol for a Prospective Longitudinal Mixed Methods Study

2021

Background: While housing and neighborhood features have the potential to impact opportunities for active aging, there is a lack of knowledge related to how older people reason regarding their housing situation and how housing and fulfillment of relocation are associated with active and healthy aging. Objective: The objectives of Prospective RELOC-AGE are to study housing choices and relocation and explore effects on active and healthy aging among men and women aged 55 years and older in Sweden considering relocation. Methods: The estimated sample (2800) will include people aged 55 years and older being listed for relocation at either of two housing companies: a local public housing company…

aging-in-placeactivityasuinympäristöasuminenpitkittäistutkimusmobilitykotona asuminenaccessibilityikääntyminenvanhuspalvelutlife-spaceliikuntakykyhousing preferencesparticipationesteettömyys ja saavutettavuusmoving expectationsikääntyneetage-friendly housingneighborhood
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Human-Animal Relationships in Supported Housing: Animal Atmospheres for Mental Health Recovery

2021

Being in a relationship with an animal can promote the well-being of people. For many individuals, this usually takes place at home. This study reports about homes for people with mental health problems (with or without co-occurring substance use), who live in supported housing operated by public landlords, entailing tenancies that are usually stricter regarding their pet policies than ordinary homes. We thus addressed the following research questions through ethnographic fieldwork at seven distinct places: which types of human–animal relationships occur in supported housing, and how do they affect the tenants? We analyzed the collected data informed by the Grounded Theory approach and foun…

business.industryPublic housingSocial connectednessmedicine.medical_treatmentAnimal-assisted therapyPublic relationsAffect (psychology)Mental healthethnographySolidarityGrounded theoryBF1-990animalsrecoveryAnimal welfareatmosphereVDP::Samfunnsvitenskap: 200::Psykologi: 260medicinePsychologybusinessPsychologyGeneral Psychologyhuman-animal relationshipmental healthOriginal Research
researchProduct

Shooting down the price: Evidence from Mafia homicides and housing prices

2022

In this paper, we estimate the effect of the homicides by the Camorra, the Neapolitan Mafia, on housing prices in Naples. The study develops on a unique panel data set at the administrative district level for the period 2002–2018 of geo-localized homicides involving innocent victims (denoted as IVH), which are treated as exogenous shocks that negatively affect housing demand. We find that the occurrence of such homicides causes a decrease in housing prices in the range of 2.5–3.8 percentage points. This effect decreases with the distance from an IVH and over time. These results are robust to the utilization of different econometric specifications and to the considerations of possible confou…

camorra housing prices organized crime spatial econometricsorganized crimespatial econometricsGeography Planning and DevelopmentEnvironmental Science (miscellaneous)Settore SECS-P/01 - Economia Politicacamorrahousing price
researchProduct

Formal property rights in the face of the substantial right to housing

2016

This paper explores the dichotomy between formal property rights and use value of rights in the field of the right to housing for homeless people, focusing on the entitlement of the squatting practices to claim the collective rights in the public domain. This collective claim can be considered an alternative to the ‘traditional’ conception of the public property as 'exclusive' domain of State. In the cities of Southern Europe, urban space has become an ‘object’ of contention by groups of inhabitants, who are organized at various levels, and an object of claiming – through illegal (although not illegitimate) forms of occupation of public or social private properties – the right to housing as…

capabilities approach right to housing squattingsquattingcapabilities approachright to housingSettore ICAR/21 - Urbanistica
researchProduct

Nuove relazioni tra tessuto urbano e agricolo nel parco del Gugliotta a Piano Tavola, Carini

2014

To the south-west of Palermo, along the north-east belt of Carini marked by Mount Colombrina and crossed by thestream Gugliotta, a wide area called Piano Tavola stretches between city and countryside. Its margins are given by the suburban volumes standing along corso Italia (west), the olive grove under Pizzo Castellaccio (east), villa Dominici (north-east), the industrial area and the railway (north), and the quarry in Manostalla locality (south-east). It is evident the pressure of the buildings on the olive grove and countryside, the presence of roads that close and isolate the district, and the lack of continuity between open spaces and built areas. The reorganization of the road network…

città in estensione campagna housingSettore ICAR/14 - Composizione Architettonica E Urbana
researchProduct

La financiación de la adquisición de viviendas: crecimiento y sus repercusiones para las cooperativas de crédito españolas

2001

La financiación de viviendas ha sido durante los últimos veinte años la actividad de crédito bancario más dinámica. A lo largo de ese período se han producido transformaciones significativas que han dotado al mercado hipotecario de una gran flexibilidad y de altas dosis de competencia. Antes de las reformas de los años 80 era un mercado con fuertes limitaciones y restringido a cajas de ahorros y al Banco Hipotecario de España. A partir de entonces se ha flexibilizado la obtención de recursos y se ha permitido la entrada de nuevos agentes. No obstante, a la hora de elegir una entidad a la hora de solicitar un crédito para adquisición de una vivienda, las familias han tenido en cuenta, además…

co-operative credit associations housing loans Spain.jel:P13Cooperatives de crèditHabitatge Finançamentjel:G21
researchProduct

Cartografías de la desigualdad : una década de conflictos de vivienda y nuevas resistencias en Santiago de Chile. Análisis del conflicto de la Maestr…

2018

RESUMEN La vivienda es en todo el mundo uno de los motivos de conflicto social más importantes en cualquier ciudad. En el caso chileno y con el movimiento de pobladores, los conflictos por la vivienda han cobrado además un protagonismo social y político muy relevante. El objetivo de este trabajo es, en primer lugar, realizar una actualización de la geografía de los conflictos de vivienda en Santiago de Chile; y en segundo lugar, analizar cómo el repertorio de protesta y las narrativas de los movimientos de pobladores han innovado y evolucionado notablemente desde su apogeo de los años sesenta hasta 1973, aumentando aun si cabe su complejidad, como veremos con un caso de conflicto: el proyec…

conflicto socialPublic housing05 social sciences0211 other engineering and technologiesvivienda021107 urban & regional planning02 engineering and technologymovimientos socialessocial conflict0506 political scienceUrban StudiesPoliticssocial movements050602 political science & public administrationHabitatgeSocial conflictHumanitieshousing
researchProduct