Search results for " Ion"

showing 10 items of 2482 documents

Coloration mechanism of electrochromic Na x WO3 thin films

2019

International audience; The coloration mechanism of tungsten trioxide (WO3) upon insertion of alkali ions is still under debate after several decades of research. This Letter provides new insights into the reversible insertion and coloration mechanisms of Na+ ions in WO3 thin films sputter-deposited on ITO/glass substrates. A unique model based on a constrained spline approach was developed and applied to draw out ε1+iε2 from spectroscopic ellipsometry data from 0.6 to 4.8 eV whatever the state of the electrochromic active layer, i.e. as-deposited, colored or bleached. It is shown that electrochemically intercalated sodium-tungsten trioxide, NaxWO3 (x=0.1, 0.2, 0.35), exhibits an absorption…

010302 applied physicsAlkali ions[PHYS]Physics [physics]Materials sciencebusiness.industry02 engineering and technology021001 nanoscience & nanotechnologyPhotochemistry01 natural sciencesTungsten trioxideAtomic and Molecular Physics and OpticsActive layerIonchemistry.chemical_compoundOpticschemistryElectrochromismAbsorption band0103 physical sciences[CHIM]Chemical SciencesThin film0210 nano-technologybusinessTrioxide
researchProduct

Irradiation effects in CaF2probed by Raman scattering

2016

The formation conditions and dynamics of Ca colloids and point defects that appear in irradiated single crystals of CaF2 were investigated by Raman spectroscopy. The intensity changes in the Raman spectra because of the presence of different concentrations of point defects and Ca colloids that emerged in CaF2 after irradiation with 2.2 GeV Au ions were used to study their distribution and stability under illumination with three laser wavelengths (473, 532 and 633 nm) at different output powers (2 to 200 mW). A damage saturation at a fluence of 6 × 1011 ion cm−2 was observed. The dependence of the spectral changes on the ion fluence can be described by a core/halo damage cross-section model.…

010302 applied physicsChemistryAnalytical chemistry02 engineering and technology021001 nanoscience & nanotechnologyLaser01 natural sciencesCrystallographic defectMolecular physicsFluencelaw.inventionIonsymbols.namesakeSwift heavy ionlaw0103 physical sciencessymbolsGeneral Materials ScienceIrradiation0210 nano-technologyRaman spectroscopySpectroscopyRaman scatteringJournal of Raman Spectroscopy
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

First experiments on applying the gasdynamic ECR ion source for negative hydrogen ion production

2017

This article has no abstract. peerReviewed

010302 applied physicsHydrogen ionta114ChemistryPhysicsQC1-99901 natural sciencesIon source010305 fluids & plasmasECR ion sourcesChemical physics0103 physical sciencesAtomic physicshydrogen ionsEPJ Web of Conferences
researchProduct

Injected 1+ ion beam as a diagnostics tool of charge breeder ECR ion source plasmas

2015

International audience; Charge breeder electron cyclotron resonance ion sources (CB-ECRIS) are used as 1+  →n+  charge multiplication devices of post-accelerated radioactive ion beams. The charge breeding process involves thermalization of the injected 1+  ions with the plasma ions in ion–ion collisions, subsequent ionization by electron impact and extraction of the n+  ions. Charge breeding experiments of 85Rb and 133Cs ion beams with the 14.5 GHz PHOENIX CB-ECRIS operating with oxygen gas demonstrate the plasma diagnostics capabilities of the 1+  injection method. Two populations can be distinguished in the m/q-spectrum of the extracted ion beams, the low (1+  and 2+) charge states repres…

010302 applied physicsIon beamAmbipolar diffusionChemistry[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]ElectronPlasmaCondensed Matter Physics01 natural sciences7. Clean energyIon source010305 fluids & plasmasIonPhysics::Plasma PhysicsIonization0103 physical sciencesAtomic physicsElectron ionization
researchProduct

New low-temperature phosphate glasses as a host for Europium Ions

2021

Abstract Artificial lightining, especially that of light emitting diodes, and telecommunications are penetrating every part of human lives daily. Different compositions phosphate glasses were suggested as a suitable host material for Eu3+ ions. Here rare earth metal ions act as luminescent centers also perturbing the bond order of phosphate glass network comprised of (PO4)3−, [−(O)PO3]2−, [−(O)2PO2]−, [−(O)3PO] structural units, which is indicated by Raman spectroscopy, confirming successful integration of aforementioned ions into the glass material. Glasses doped with Eu3+ ions show their typical photoluminescence spectra in low symmetry environment, consisting of the highest intensity 5D0…

010302 applied physicsMaterials scienceBorosilicate glassMetal ions in aqueous solutionInorganic chemistryDopingchemistry.chemical_elementGermanium02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsPhosphate glasssymbols.namesakechemistry0103 physical sciencesMaterials ChemistryCeramics and Compositessymbols0210 nano-technologyEuropiumLuminescenceRaman spectroscopyJournal of Non-Crystalline Solids
researchProduct

Magnetization reversal of the domain structure in the anti-perovskite nitride Co3FeN investigated by high-resolution X-ray microscopy

2016

We performed X-ray magnetic circular dichroism (XMCD) photoemission electron microscopy imaging to reveal the magnetic domain structure of anti-perovskite nitride Co3FeN exhibiting a negative spin polarization. In square and disc patterns, we systematically and quantitatively determined the statistics of the stable states as a function of geometry. By direct imaging during the application of a magnetic field, we revealed the magnetic reversal process in a spatially resolved manner. We compared the hysteresis on the continuous area and the square patterns from the magnetic field-dependent XMCD ratio, which can be explained as resulting from the effect of the shape anisotropy, present in nano…

010302 applied physicsMaterials scienceCondensed matter physicsMagnetic domainGeneral Physics and AstronomyMagnetic resonance force microscopyLarge scale facilities for research with photons neutrons and ions02 engineering and technology021001 nanoscience & nanotechnologyMagnetic hysteresis01 natural sciencesMagnetic susceptibilityCondensed Matter::Materials ScienceParamagnetismMagnetic anisotropyX-ray magnetic circular dichroism0103 physical sciencesMagnetic force microscope0210 nano-technologyJournal of Applied Physics
researchProduct

A quartz amplifier for high-sensitivity Fourier-transform ion-cyclotron-resonance measurements with trapped ions

2019

Single-ion sensitivity is obtained in precision Penning-trap experiments devoted to light (anti)particles or ions with low mass-to-charge ratios, by adding an inductance coil to an amplifier connected to the trap, both operated at 4 K. However, single-ion sensitivity has not been reached on heavy singly or doubly charged ions. In this publication, we present a new system to reach this point, based on the use of a quartz crystal as an inductance, together with a newly developed broad-band (BB) amplifier. We detect the reduced-cyclotron frequency of 40Ca+ ions stored in a 7-tesla open-ring Penning trap. By comparing the detected electric signal obtained with the BB amplifier and the fluoresce…

010302 applied physicsMaterials scienceEquivalent series resistanceAmplifierPenning trap01 natural sciences7. Clean energySignalFourier transform ion cyclotron resonance010305 fluids & plasmasIonCrystal0103 physical sciencesAtomic physicsInstrumentationSensitivity (electronics)Review of Scientific Instruments
researchProduct

A new 18 GHz room temperature electron cyclotron resonance ion source for highly charged ion beams

2020

An innovative 18 GHz HIISI (Heavy Ion Ion Source Injector) room temperature Electron Cyclotron Resonance (ECR) ion source (ECRIS) has been designed and constructed at the Department of Physics, University of Jyväskylä (JYFL), for the nuclear physics program of the JYFL Accelerator Laboratory. The primary objective of HIISI is to increase the intensities of medium charge states (M/Q ≅ 5) by a factor of 10 in comparison with the JYFL 14 GHz ECRIS and to increase the maximum usable xenon charge state from 35+ to 44+ to serve the space electronics irradiation testing program. HIISI is equipped with a refrigerated permanent magnet hexapole and a noncylindrical plasma chamber to achieve very stro…

010302 applied physicsMaterials scienceIon beamsyklotronittutkimuslaitteetHighly charged ionchemistry.chemical_elementhiukkaskiihdyttimet01 natural sciences7. Clean energyIon sourceElectron cyclotron resonance010305 fluids & plasmasIonXenonchemistry0103 physical sciencesIrradiationAtomic physicsInstrumentationBeam (structure)
researchProduct

Optimization of a laser ion source for $^{163}$Ho isotope separation

2019

To measure the mass of the electron neutrino, the “Electron Capture in Holmium-163” (ECHo) collaboration aims at calorimetrically measuring the spectrum following electron capture in 163Ho. The success of the ECHo experiment depends critically on the radiochemical purity of the 163Ho sample, which is ion-implanted into the calorimeters. For this, a 30 kV high transmission magnetic mass separator equipped with a resonance ionization laser ion source is used. To meet the ECHo requirements, the ion source unit was optimized with respect to its thermal characteristics and material composition by means of the finite element method thermal-electric calculations and chemical equilibrium simulation…

010302 applied physicsMaterials sciencePhysics - Instrumentation and DetectorsAtomic Physics (physics.atom-ph)Electron captureFOS: Physical sciencesThermal ionizationInstrumentation and Detectors (physics.ins-det)Laser01 natural sciencesIon source010305 fluids & plasmasIsotope separationlaw.inventionPhysics - Atomic PhysicslawIonization0103 physical sciencesThermalAtomic physicsChemical equilibriumInstrumentation
researchProduct