Search results for " Learning"

showing 10 items of 5299 documents

Influence of the learning environment on the representational strategies of middle school music students: an intervention-based study

2015

The purpose of this study was to examine the effects of a hypermedia learning environment on middle school students' meta-representational competence (MRC) in the domain of music. Particularly, we aimed at determining whether an educational intervention influenced the accuracy with which middle school students matched sounds (sonic fragments) to symbols (graphic representations). The students were randomly allocated to the experimental condition. An intervention was set up so that the experimental group students (E) were provided with scaffolding aimed at enhancing their use of constructive resources to generate representations and their critical capabilities to judge them. On the other han…

technology enhanced learning environmentrepresentationeducationecological perceptionmusic education:PEDAGOGÍA [UNESCO]sound-to-symbol matchingUNESCO::PEDAGOGÍA
researchProduct

Employee opportunities for self-directed learning at technology organisations : features and frames of self-directed learning projects

2020

The importance of self-directed learning (SDL) in a business environment has been highlighted as a way to increase an organisation’s competitiveness and innovativeness. While organisations increasingly require SDL from employees, less attention is paid to the situations and frames enabling it. This study examines self-directed learning projects (SDLPs), situations in which SDL is realised as an individual or collective phenomenon. Based on ethnographic research, this study’s data consisted of field notes, field records and interviews. I used analysis of key incidents and ethnographic content analysis as an analytical tools. Four types of SDLPs was identified in the organisations studied: or…

technology-based workKnowledge managementetnografiaoppiminenbusiness.industry05 social sciencesitseohjautuvuus050301 educationethnographyEducationBusiness environmentteknologiakasvatusself-directed learning0502 economics and businessEthnographyAutodidacticismbusiness0503 educationself-directed learning projects050203 business & management
researchProduct

Professional identity in relation to vocational teachers’ work : an identity-centred approach to professional development

2018

This paper reports a study on teachers’ professional identity and work in vocational education. The findings showed that vocational teachers’ work included vocational teaching within the school, developmental work, technology-enhanced work, professional duties outside the school, and educational duties within the school. Furthermore, the study revealed the harmonious and tensioned relationships between these elements of the work and teachers’ identities. Recognition of the nuanced nature of these relationships provides a perspective for promoting teachers’ professional development. From a practical perspective, there is a need to support vocational teachers’ identity work and the adoption o…

technology-enhanced education21st century skillsApprenticeshipIdentity (social science)ammatilliset opettajatEducationammatti-identiteettivocational teacherswork0502 economics and businessPedagogyVocational Education and TrainingtyössäoppiminenWorkplace LearningProfessional identityoppisopimuskoulutusta516Sociologyprofessional identityRelation (history of concept)4. Education05 social sciencesProfessional development050301 educationWork (electrical)ammatillinen kehitysVocational educationFaculty development0503 education050203 business & managementprofessional developmentLearning : Research and Practice
researchProduct

TEL@work: Toward integration of theory and practice

2014

This paper examines technology-enhanced learning at work in the context of the integrative pedagogy model. The basic idea behind this model is to create learning environments whereby the four basic elements of professional expertise (ie, theoretical, practical, self-regulative and sociocultural knowledge) can be integrated. The paper illustrates two basic ways of applying the model in technology-enhanced learning at work. First, examples of how to make use of existing technologies, especially social media, to empower learning at work is presented, and second, an instance of the way the model is used in the design of specific technologies for enhancing collaborative learning in the work cont…

technology-enhanced learning
researchProduct

Teachers’ work-related well-being in times of covid-19: the effects of technostress and distance learning

2022

Following the outbreak of the COVID-19 pandemic, one of the first measures implemented in Italy was the transition from frontal teaching to e-learning. The sudden need to use technologies to perform their job has added a source of stress to teachers’ work, the so-called technostress. The difficulties experienced in this transition may also have affected the perception of work-related well-being, although other variables, such as the perception of the meaningfulness of work, could alleviate this sense of uneasiness. The study aims to examine the relationships between technostress, distance learning, pleasure in working and meaningful work perceptions among 219 teachers from different school …

technostrewell-beingdistance learningCOVID-19Settore M-PSI/06 - Psicologia Del Lavoro E Delle Organizzazioniteacher
researchProduct

Educación XX1 : revista de la Facultad de Educación

2019

Los avances tecnológicos han provocado que el ámbito de la educación se vea influenciado por la aparición de nuevos modelos de enseñanza y aprendizaje mediados por la gran cantidad de recursos digitales y dispositivos electrónicos que cuenta hoy el profesorado. Uno de los enfoques metodológicos que está emergiendo como consecuencia de la innovación educativa es el flipped learning. Este modelo de enseñanza y aprendizaje se sustenta en la idea de que los discentes puedan visualizar y trabajar los contenidos de las próximas sesiones presenciales en el aula fuera del entorno académico, con la finalidad de dedicar el mayor tiempo posible en clase a la resolución de problemas y al despliegue de …

tecnología de la informaciónsolución de problemasenseñanza semipresencialProcess (engineering)media_common.quotation_subjectmotivación050801 communication & media studiesSample (statistics)Context (language use)Análisis estructuralField (computer science)Education0508 media and communicationsMathematics educationProceso de aprendizajeCondiciones de aprendizajemedia_commonsituación familiarClass (computer programming)autonomía05 social sciences050301 educationCitizen journalismTecnologías de la Información y Comunicación (TIC)tecnología de la educacióncooperaciónSoftware deploymentautoestimaInnovación pedagógicaPsychologyFlipped learningrendimientoparticipación0503 educationAutonomy
researchProduct

Avaluació i anàlisi de tutoríes virtual realitzades amb estudiants d'Enginyeria

2010

En aquest article, els autors descriuen com l'ús de plataformes de treball col·laboratiu ajuda a la millora de competències d'estudiants d'enginyeria, així com a la millora contínua de la qualitat de l'ensenyança. Conseqüentment, a través de la implicació dels estudiants que han participat activament en l'experiència d'innovació docent, s'ha aconseguit l'objectiu principal de l'estudi proposat. Els resultats obtinguts mostren amb èxit el grau d'impacte en la qualitat de la docència (concretament en allò relacionat amb tutories docents) a través de l'ús d'una nova plataforma de treball col·laboratiu: ConferenceXP.

tecnologías de la información y la comunicaciónblended learning mentoring competences teaching innovation ITCtecnologías de la información y la comunicación; matemáticasmatemáticas
researchProduct

Educational innovation through ICTs in the university setting. What do students think of these practices?

2014

Aquest document vol donar a conèixer l'experiència duta a terme per un grup d'estudiants durant el desenvolupament d'un programa destinat a alumnes innovadors de la Universitat de València. La immersió actual de les tecnologies en tots els àmbits de la societat i en l'educació planteja noves incògnites sobre com es desenvolupen aquestes experiències educatives. El projecte presentat era enfocat als alumnes amb vista a desenvolupar un treball que relacionés les tecnologies de la informació i la comunicació (TIC) amb els contextos d'aprenentatge universitaris. Així, en l'article es presenten les experiències, vivències i conclusions a les quals s'ha arribat quan s'ha acabat el projecte.

tecnologías de la información; aprendizaje activo; aprendizaje cooperativo; innovación educativatecnologies de la informació; aprenentatge actiu; aprenentatge cooperatiu; innovació educativainformation technologies; active learning; cooperative learning; educational innovationEducationRUSC. Revista de Universidad y Sociedad del Conocimiento
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

CCTV-FullyAware: toward end-to-end feasible privacy-enhancing and CCTV forensics applications

2022

It is estimated that over 1 billion Closed-Circuit Television (CCTV) cameras are operational worldwide. The advertised main benefits of CCTV cameras have always been the same; physical security, safety, and crime deterrence. The current scale and rate of deployment of CCTV cameras bring additional research and technical challenges for CCTV forensics as well, as for privacy enhancements. This paper presents the first end-to-end system for CCTV forensics and feasible privacy-enhancing applications such as exposure measurement, CCTV route recovery, CCTV-aware routing/navigation, and crowd-sourcing. For this, we developed and evaluated four complex and distinct modules (CCTVCV [1], OSRM-CCTV [2],…

tekninen rikostutkintatietosuojamachine learningkoneoppiminenyksityisyyskameravalvontaobject detectionvideo surveillancekonenäkönavigationsovellusohjelmatyksilönsuojaprivacy-enhancing technologies2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct