Search results for " Resonance"

showing 10 items of 5579 documents

Synchronous precessional motion of multiple domain in a ferromagnetic nanowire by perpendicular field pulses

2014

Magnetic storage and logic devices based on magnetic domain wall motion rely on the precise and synchronous displacement of multiple domain walls. The conventional approach using magnetic fields does not allow for the synchronous motion of multiple domains. As an alternative method, synchronous current-induced domain wall motion was studied, but the required high-current densities prevent widespread use in devices. Here we demonstrate a radically different approach: we use out-of-plane magnetic field pulses to move in-plane domains, thus combining field-induced magnetization dynamics with the ability to move neighbouring domain walls in the same direction. Micromagnetic simulations suggest …

010302 applied physicsPhysicsMagnetization dynamicsMultidisciplinaryMagnetic domainCondensed matter physicsField (physics)Magnetic storageGeneral Physics and Astronomy02 engineering and technologyGeneral Chemistry021001 nanoscience & nanotechnology01 natural sciencesGeneral Biochemistry Genetics and Molecular BiologyDisplacement (vector)Articlelaw.inventionDomain (software engineering)Magnetic fieldNuclear magnetic resonanceDomain wall (magnetism)law0103 physical sciencesddc:5300210 nano-technologyNature Communications
researchProduct

The effect of plasma electrode collar structure on the performance of the JYFL 14GHz electron cyclotron resonance ion source

2013

Abstract The influence of a so-called collar structure on the performance of the JYFL 14 GHz electron cyclotron resonance ion source (ECRIS) has been studied experimentally at the Department of Physics, University of Jyvaskyla (JYFL). The collar is a cylindrical structure extruding inwards from the plasma electrode. The collar length was varied between 5 and 60 mm. For some ion species a moderate performance improvement was achieved in terms of extracted beam current and transverse emittance up to 30 mm collar length. Longer collars resulted in a substantial performance decrease. Different collar materials, i.e. nonmagnetic stainless steel, aluminum and Al 2 O 3 , and a wide range of ion sp…

010302 applied physicsPhysicsNuclear and High Energy Physicsta114Plasma01 natural sciences7. Clean energyElectron cyclotron resonanceIon source010305 fluids & plasmasCollarIon0103 physical sciencesElectrodeThermal emittanceddc:530Atomic physicsInstrumentationBeam (structure)
researchProduct

Broadband microwave emission spectrum associated with kinetic instabilities in minimum-B ECR plasmas

2017

Plasmas of electron cyclotron resonance ion sources (ECRISs) are prone to kinetic instabilities due to the resonant heating mechanism resulting in anisotropic electron velocity distribution. Frequently observed periodic oscillations of extracted ion beam current in the case of high plasma heating power and/or strong magnetic field have been proven to be caused by cyclotrontype instabilities leading to a notable reduction and temporal variation of highly charged ion production. Thus, investigations of such instabilities and techniques for their suppression have become important topics in ECRIS research. The microwave emission caused by the instabilities contains information on the electron e…

010302 applied physicsPhysicsRange (particle radiation)microwave sourcesIon sourcesIon beamta114Highly charged ionPlasmaAstrophysics::Cosmology and Extragalactic Astrophysicsplasma instabilitiesmagnetic fieldsCondensed Matter PhysicsPlasma oscillationmagneettikentät01 natural sciences7. Clean energyElectron cyclotron resonanceIonPhysics::Plasma Physicsmicrowave spectra0103 physical sciencesAtomic physics010306 general physicsMicrowave
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

International audience; To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr ) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr –ratio when the injection, extraction and radial mi…

010302 applied physicsPhysics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceBremsstrahlungResonancePlasmaCondensed Matter Physics01 natural sciencesElectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmasMagnetic fieldNuclear Energy and Engineering0103 physical sciencesAtomic physicsMicrowave
researchProduct

Control flow strategy in a receiver coil for nuclear magnetic resonance for imaging

2020

A mathematical discussion is introduced to describe the receiver coil characterizing a nuclear magnetic resonance for imaging, starting from a general shape of the conductor. A set of different inductance calculations have been introduced, varying the shape of the conductor. The inductance calculation led to a general expression of the magnetic field of a single coil characterized by a rectangular shape. A dynamic model of the receiver coil has been developed to represent the natural frequencies that characterize the operational bandwidth. A nonstationary control strategy is implemented to make a real time changing of the operational bandwidth. The frequency response of the coil generates …

010302 applied physicsPhysicsmedicine.diagnostic_testMechanical EngineeringAerospace EngineeringMagnetic resonance imaging01 natural sciencesTransfer function030218 nuclear medicine & medical imagingMagnetic fieldConductorInductanceReceiver coil03 medical and health sciences0302 clinical medicineNuclear magnetic resonanceControl flowMechanics of Materials0103 physical sciencesAutomotive EngineeringmedicineGeneral Materials ScienceJournal of Vibration and Control
researchProduct

Cyclotron instability in the afterglow mode of minimum-B ECRIS.

2016

It was shown recently that cyclotron instability in non-equilibrium plasma of a minimum-B electron cyclotron resonance ion source (ECRIS) causes perturbation of the extracted ion current and generation of strong bursts of bremsstrahlung emission, which limit the performance of the ion source. The present work is devoted to the dynamic regimes of plasma instability in ECRIS operated in pulsed mode. Instability develops in decaying plasma shortly after heating microwaves are switched off and manifests itself in the form of powerful pulses of electromagnetic emission associated with precipitation of high energy electrons. Time-resolved measurements of microwave emission bursts are presented. I…

010302 applied physicsPhysicsta114ta213Astrophysics::High Energy Astrophysical Phenomenaplasma instabilityCyclotronBremsstrahlungPlasma01 natural sciencesInstabilityIon sourceElectron cyclotron resonance010305 fluids & plasmaslaw.inventionTwo-stream instabilityPhysics::Plasma Physicslaw0103 physical scienceselectron cyclotron resonance ion sourcesAtomic physicsInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

Spectroscopic study of the electric field induced valence change of Fe-defect centers in SrTiO(3)

2011

The electrochemical changes induced by an electric field in Fe-doped SrTiO(3) have been investigated by X-ray absorption spectroscopy (XANES and EXAFS), electron paramagnetic resonance (EPR) and Raman spectroscopy. A detailed study of the Fe dopant in the regions around the anode and cathode reveals new insights into the local structure and valence state of Fe in SrTiO(3) single crystals. The ab initio full multiple-scattering XANES calculations give an evidence of the oxygen vacancy presence in the first coordination shell of iron. Differences in the length and disorder of the Fe-O bonds as extracted from EXAFS are correlated to the unequivocal identification of the defect type by compleme…

010302 applied physicsValence (chemistry)Absorption spectroscopyExtended X-ray absorption fine structureChemistryAb initioGeneral Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesXANESlaw.inventionJsymbols.namesakeCrystallographyOxidation statelaw0103 physical sciencesddc:540symbolsPhysical and Theoretical Chemistry0210 nano-technologyElectron paramagnetic resonanceRaman spectroscopy
researchProduct

Normal and relaxor ferroelectric behavior in the Ba1−xPbx(Ti1−yZry)O3 solid solutions

2017

Abstract Polycrystalline samples of Ba 1−x Pb x (Ti 1−y Zr y )O 3 (BPTZ) with x = 0.025 & 0.1 and 0.10 ≤ y ≤ 0.50 have been synthesized by high-temperature solid-state reaction technique. X-ray diffraction reveals the formation of single phase with tetragonal or cubic structure. Dielectric investigations were carried out in the temperature range from 80 to 445 K with frequencies range from 10 2 to 10 6  Hz. A broad dielectric anomaly coupled with the shift of dielectric maxima toward a higher temperature with increasing frequency indicates either a diffuse phase transition or relaxor behavior in some of these ceramics. Whatever lead content, when zirconium is substituted by titanium, T C an…

010302 applied physicsZirconiumPhase transitionMaterials scienceMechanical EngineeringMetals and AlloysAnalytical chemistrychemistry.chemical_element02 engineering and technologyDielectricAtmospheric temperature range021001 nanoscience & nanotechnology01 natural sciencesDielectric spectroscopyTetragonal crystal systemNuclear magnetic resonancechemistryMechanics of Materials0103 physical sciencesX-ray crystallographyMaterials Chemistry0210 nano-technologySolid solutionJournal of Alloys and Compounds
researchProduct

The biased disc of an electron cyclotron resonance ion source as a probe of instability-induced electron and ion losses

2019

International audience; Electron Cyclotron Resonance Ion Source (ECRIS) plasmas are prone to kinetic instabilities resulting in loss of electron and ion confinement. It is demonstrated that the biased disk of an ECRIS can be used as a probe to quantify such instability-induced electron and ion losses occurring in less than 10 µs. The qualitative interpretation of the data is supported by the measurement of the energy spread of the extracted ion beams implying a transient plasma potential >1.5 kV during the instability. A parametric study of the electron losses combined with electron tracking simulations allows for estimating the fraction of electrons expelled in each instability event to be…

010302 applied physics[PHYS]Physics [physics]Materials sciencesyklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]ElectronPlasmahiukkaskiihdyttimetKinetic energyplasmafysiikka01 natural sciencesInstabilityElectron cyclotron resonanceIon source010305 fluids & plasmasIonPhysics::Plasma Physics0103 physical sciencesTransient (oscillation)Atomic physicsInstrumentation
researchProduct