Search results for " Transport"

showing 10 items of 3573 documents

L'apport de la communication engageante et des représentations sociales dans le cadre de la promotion de l'éco-mobilité

2011

The purpose of this thesis was to test the applicability of binding communication in the case of car use reduction. The first two studies (1 & 2) bring out the relationship between an individual and his mobility. Our results lead us to consider a system of double bind between the challenges of sustainable development and daily obligations. The individual recognizes the negative impact of car use on the environment but justifies his behavior by an important need for flexibility. Three studies have tested the effectiveness of procedures such as commitment (Study 3) and binding communication (studies 4 and 5). A procedure of binding communication has been particularly effective. It combined a …

social representationeco-friendly transport mode choicethéorie du comportement planifiécommitmentéco-mobilité[ SCCO.PSYC ] Cognitive science/Psychologycommunication engageantereprésentation socialebehavioral change[SCCO.PSYC] Cognitive science/Psychologycognitive changechangement comportementaltheory of planned behaviorchangement cognitifbinding communicationengagement
researchProduct

Sediment delivery processes and chemical transport in a small forested basin

2005

Recent reaserch has directed attention to the properties of the eroded material because of its influence in deposition phenomena and in carrying capacity of pollutant materials

soil erosionforested basinchemical enrichment ratioexperimental basinSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-Forestaliuniversal soil loss equationchemical transportsediment yieldgeographical information system
researchProduct

DESIGN OF SF3B1 SUBUNIT MODULATORS OF THE SF3B SPLICEOSOME COMPLEX

2022

The subject of this dissertation is the search for new therapeutic strategies for pancreatic cancer and aims to implement a Drug Discovery process for the rational design and synthesis of molecules active in the modulation of pathways related to the regulation of pre-mRNA splicing process. This research project is the result of a joint PhD between the University of Palermo, Italy, and the Department of Medical Oncology, VU University Medical Center, Amsterdam, The Netherlands. It integrates complementary skills in pharmaceutical chemistry and translational cancer research with a special focus on the rational design of new anticancer compounds potentially active on SF3B1 (Splicing Factor 3B …

splicing4]thiadiazole compoundsdrug resistancehuman equilibrative nucleoside transporter-13mesotheliomaSF3B1gemcitabinepancreatic ductal adenocarcinoma1-b][1SF3B1 splicing imidazo[21-b][134]thiadiazole compounds pancreatic ductal adenocarcinoma gemcitabine human equilibrative nucleoside transporter-1 drug resistance mesotheliomaimidazo[2
researchProduct

Thermoelectric devices and supercapacitors based on nanostructured semiconducting polymers for energy production and storage

2017

Más de dos terceras partes de la energía generada por las fuentes convencionales se pierden como calor. Recuperar esas pérdidas de energía puede ayudar a crear una forma más eficiente de producir energía para el desarrollo sostenible de nuestra sociedad. Mediante el uso de generadores termoeléctricos es posible producir energía a partir de gradientes de temperatura de tal manera que la termoelectricidad puede ser una buena estrategia para la recolección y recuperación de energía. La eficiencia termoeléctrica suele ser dada por la figura adimensional de mérito, ZT. Actualmente, los materiales inorgánicos se usan comúnmente en aplicaciones termoeléctricas, sin embargo presentan varias desvent…

supercondensadores:FÍSICA::Química física::Química-Física de Polímeros [UNESCO]:FÍSICA::Física del estado sólido ::Materiales compuestos [UNESCO]UNESCO::QUÍMICAUNESCO::FÍSICA::Física del estado sólido ::Materiales compuestosUNESCO::FÍSICA::Química física::Química-Física de Polímerospolímeros conductoresUNESCO::QUÍMICA::Química macromolecular ::Otras:FÍSICA::Física del estado sólido ::Propiedades de transporte de electrones [UNESCO]Termoelectricidad:QUÍMICA [UNESCO]:QUÍMICA::Química macromolecular ::Otras [UNESCO]UNESCO::FÍSICA::Física del estado sólido ::Propiedades de transporte de electrones
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Composite Membranes of Sulfonated Poly(ether ether ketone) with Active Carbon: Composite Preparation and Investigation of their Properties for Potent…

2020

Authors of this work acknowledge funding from European Union`s Horizon 2020 Research and Innovation Program project under grant agreement No 768789.

surface zeta potentiallcsh:TN1-997Thermogravimetric analysisMaterials science020209 energySynthetic membraneimpedance analysisEther02 engineering and technology7. Clean energychemistry.chemical_compoundSulfonated poly(ether ether ketone)0203 mechanical engineering:NATURAL SCIENCES:Physics [Research Subject Categories]0202 electrical engineering electronic engineering information engineeringZeta potentialmedicineGeneral Materials Sciencelcsh:Mining engineering. Metallurgychemistry.chemical_classificationImpedance analysisSurface zeta potentialSulfuric acidco2 reductionPolymersulfonated poly(ether ether ketone)020303 mechanical engineering & transportsMembranechemistryChemical engineeringCO2 reductionSwellingmedicine.symptomMedžiagotyra
researchProduct

Particle tracking in a gap of aquatic vegetation meadow

2009

Aquatic vegetation considerably affects the flow field in water bodies, with influence increasing as the depth decreases. As a consequence, vegetation also affects suspended particle transport. In inshore sandy beds less than 40 m deep of the Mediterranean Sea, meadows of Posidonia oceanica are widespread. This plant is constituted by a tuft of very thin and flexible ribbon-like leaves about 1 cm wide and up to 1.5 m long; the meadow areal density can reach 1000-1200 plant/m2. Frequently, such meadows are not continuous but vegetated areas alternate with sand strips (“gaps”). The presence of such discontinuities noticeably affects the flow field and gaps can actually act as particle traps. …

suspended transportturbulenceshallow waterAquatic vegetationparticle trackingSettore ICAR/01 - Idraulica
researchProduct

Measuring Socio-Economic Welfare and Sustainable Transport – Selected Dilemmas

2017

The aim of this paper is to present and elaborate relations between the understanding and main indicators of socio-economic welfare, including indicators of sustainable development, and the measurement methods of sustainable transport. The focus is on the role that transport basically plays for nearly all dimensions of living conditions and the quality of life. First, the defi nition of socio-economic welfare and different views on measuring welfare are presented. Then, the meaning of transport for improving socio-economic aspects of life, as well as the need for sustainable transport are underlined. In the last part of the article developed indicators of sustainable transport are discussed…

sustainable transportwell-beingtransportsocio-economic welfareindicatorsEkonomia i Środowisko
researchProduct

MUV: A Game to Encourage Sustainable Mobility Habits

2019

This working paper investigates the question of changing people mobility towards more sustainable habits involving them in an engaging gameplay. The work is performed within MUV H2020 research and innovation action. The game design, definition and features have been co-created through the involvement of different citizens and stakeholders in six European neighbourhoods. The paper discusses the game design as resulting from co-creation and co-design experiences with each neighbourhood communities involved in initial phases. The paper argues that the local co-design activities have influenced the game definition, together with the community engagement approach. The MUV gameplay approach resul…

sustainable urban mobilityCo-creation; Community engagement; Gamification; Urban sustainable mobility; Theoretical Computer Science; Computer Science (all)community engagementEconomic JusticeTheoretical Computer ScienceGame design11. Sustainability0502 economics and businessSettore ICAR/13 - Disegno IndustrialeCo-creationgamificationSociologyNeighbourhood (mathematics)060201 languages & linguistics050210 logistics & transportationSettore ICAR/20 - Tecnica E Pianificazione UrbanisticaCommunity engagementbusiness.industryCo-creationCommunity engagementComputer Science (all)05 social sciencesEquity (finance)06 humanities and the artsPublic relationsGamificationWork (electrical)Action (philosophy)0602 languages and literatureUrban sustainable mobilitybusinessco-creation
researchProduct

Electrical Transport and Confocal Raman Studies of Electrochemically Modified Individual Carbon Nanotubes

2003

symbols.namesakeMaterials scienceElectrical transportMechanics of MaterialslawMechanical EngineeringConfocalsymbolsGeneral Materials ScienceNanotechnologyCarbon nanotubeRaman spectroscopylaw.inventionAdvanced Materials
researchProduct