Search results for " c.c."

showing 10 items of 4655 documents

Neurovascular EGFL7 regulates adult neurogenesis in the subventricular zone and thereby affects olfactory perception

2016

Adult neural stem cells reside in a specialized niche in the subventricular zone (SVZ). Throughout life they give rise to adult-born neurons in the olfactory bulb (OB), thus contributing to neural plasticity and pattern discrimination. Here, we show that the neurovascular protein EGFL7 is secreted by endothelial cells and neural stem cells (NSCs) of the SVZ to shape the vascular stem-cell niche. Loss of EGFL7 causes an accumulation of activated NSCs, which display enhanced activity and re-entry into the cell cycle. EGFL7 pushes activated NSCs towards quiescence and neuronal progeny towards differentiation. This is achieved by promoting Dll4-induced Notch signalling at the blood vessel-stem …

Male0301 basic medicineGeneral Physics and AstronomyNEURAL STEM-CELLSMOUSEMiceSUBEPENDYMAL ZONENeural Stem CellsLateral VentriclesLINEAGE PROGRESSIONBRAININ-VIVOMice KnockoutNeuronal PlasticityMultidisciplinaryCell CycleQNeurogenesisNICHEAnatomyNeural stem cellCell biologyAdult Stem Cellsmedicine.anatomical_structureSignal TransductionSTIMULATES NEUROGENESISEGF Family of ProteinsNeurogenesisScienceNotch signaling pathwaySubventricular zoneBiologyInhibitory postsynaptic potentialArticleGeneral Biochemistry Genetics and Molecular Biology03 medical and health sciencesNeuroplasticitymedicineBiological neural networkAnimalsCalcium-Binding ProteinsProteinsGeneral ChemistryOlfactory PerceptionENDOTHELIAL-CELLSnervous system diseasesOlfactory bulbMice Inbred C57BLSELF-RENEWAL030104 developmental biologynervous system
researchProduct

Neuromuscular function during drop jumps in young and elderly males

2011

The Hoffman reflex (H-reflex), indicating alpha-motoneuron pool activity, has been shown to be task - and in resting conditions - age dependent. How aging affects H-reflex activity during explosive movements is not clear at present. The purpose of this study was to examine the effects of aging on H-reflexes during drop jumps, and its possible role in drop jump performance. Ten young (26.8 ± 2.7 years) and twenty elderly (64.2 ± 2.7 years) subjects participated in the study. Maximal drop jump performance and soleus H-reflex response (H/M jump) 20 ms after ground contact were measured in a sledge ergometer. Maximal H-reflex, maximal M-wave, Hmax/Mmax-ratio and H-reflex excitability curves wer…

AdultMaleAgingmedicine.medical_specialtyMovementBiophysicsNeuroscience (miscellaneous)Electromyographymedicine.disease_causeStretch shortening cycleH-ReflexJumpingInternal medicinemedicineHumansHoffman reflexMuscle SkeletalMathematicsmedicine.diagnostic_testElectromyographyDrop (liquid)Middle AgedLower ExtremityDrop jumpPhysical therapyCardiologyJumpNeurology (clinical)H-reflexJournal of Electromyography and Kinesiology
researchProduct

A Molecular Electron Density Theory Study of the Reactivity of Azomethine Imine in [3+2] Cycloaddition Reactions

2017

The electronic structure and the participation of the simplest azomethine imine (AI) in [3+2] cycloaddition (32CA) reactions have been analysed within the Molecular Electron Density Theory (MEDT) using DFT calculations at the MPWB1K/6-311G(d) level. Electron localisation function (ELF) topological analysis reveals that AI has a pseudoradical structure, while the conceptual DFT reactivity indices characterise this TAC as a moderate electrophile and a good nucleophile. The non-polar 32CA reaction of AI with ethylene takes place through a one-step mechanism with low activation energy, 5.3 kcal/mol-1. A bonding evolution theory (BET) study indicates that this reaction takes place through a non-…

Models MolecularThiosemicarbazones[3+2] cycloaddition reactionsImineMolecular Conformationmolecular mechanismsazomethine iminePharmaceutical ScienceElectronsElectronic structureActivation energy010402 general chemistry01 natural sciencesArticlebonding evolution theoryAnalytical Chemistrychemistry.chemical_compoundNucleophileComputational chemistryDrug Discoveryconceptual density functional theoryMoleculeReactivity (chemistry)organic_chemistryelectron densityPhysical and Theoretical Chemistryazomethine imine; [3+2] cycloaddition reactions; molecular electron density theory; conceptual density functional theory; electron localisation function; bonding evolution theory; electron density; molecular mechanisms; chemical reactivityCycloaddition ReactionMolecular Structure010405 organic chemistrymolecular electron density theoryOrganic ChemistryCycloaddition0104 chemical scienceschemistryChemistry (miscellaneous)ElectrophileQuantum TheoryThermodynamicsMolecular MedicineDensity functional theoryImineselectron localisation functionAzo Compoundschemical reactivityMolecules; Volume 22; Issue 5; Pages: 750
researchProduct

Nature of Interactions at the Interface of Two Water-Saturated Commercial TiO2 Polymorphs

2013

Two commercial TiO2 samples, a 100% anatase and a 100% rutile, were used for the fast field cycling NMR experiments. The results showed a different behavior between the different samples. In particular, water molecules were unbonded to the solid surface for the rutile sample, whereas they appeared to chemically interact with the surface through H-bond formation with the anatase sample. The above findings accord with the generally lower activity of rutile with respect to anatase reported in literature for photocatalytic oxidation reactions in water. The difficulty of water to interact with rutile surface, indeed, could hinder the formation of OH radicals, which are the most important oxidant…

AnataseMaterials scienceField cyclingInterface (Java)relaxometrySettore AGR/13 - Chimica AgrariaMineralogySurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsGeneral EnergyChemical engineeringRutileSettore CHIM/07 - Fondamenti Chimici Delle TecnologiePhysical and Theoretical ChemistryThe Journal of Physical Chemistry C
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Endometrial Receptivity Analysis (ERA): data versus opinions

2021

Abstract This article summarises and contextualises the accumulated basic and clinical data on the ERA test and addresses specific comments and opinions presented by the opponent as part of an invited debate. Progress in medicine depends on new technologies and concepts that translate to practice to solve long-standing problems. In a key example, combining RNA sequencing data (transcriptomics) with artificial intelligence (AI) led to a clinical revolution in personalising disease diagnosis and fostered the concept of precision medicine. The reproductive field is no exception. Translation of endometrial transcriptomics to the clinic yielded an objective definition of the limited time period …

0301 basic medicine030219 obstetrics & reproductive medicineendometrial receptivitybusiness.industryNatural cycleHormonal replacement therapyEmbryoimplantation / recurrent implantation failureDiseaseEndometriumPrecision medicineBioinformaticsAcademicSubjects/MED00905Embryo transfer03 medical and health sciences030104 developmental biology0302 clinical medicinemedicine.anatomical_structureDebate ContinuedmedicineendometriumEndometrial receptivitybusinessembryo transferHuman Reproduction Open
researchProduct

Attraction to male pheromones and sexual behaviour show different regulatory mechanisms in female mice.

2004

In rodents, female sexual behaviour is under hormonal control. The attraction females show for male-derived nonvolatile chemicals (pheromones) can be regarded as the first step of this behaviour, but it is unknown whether this attraction is also modulated by sexual steroids. To test this possibility, ovariectomized adult female mice with no experience of chemical signals from adult males were randomly assigned to four groups that received oil (control), progesterone, estradiol (E) or estradiol+progesterone (E+P) injections, respectively. Females were then tested for their attraction to male-soiled bedding and, subsequently, for their proceptive behaviour when confronted to adult males. Fema…

Malemedicine.medical_specialtyAgingsteroid hormonesVomeronasal organExperimental and Cognitive PsychologyProceptive phaseBiologyPheromonesvomeronasal systemBehavioral NeuroscienceMiceSexual Behavior AnimalInternal medicinemedicineAnimalsEstrous cycleSex CharacteristicsamygdalaAttractionSexual intercourseEndocrinologySex pheromoneExploratory BehaviorPheromoneFemaleSteroidsfemale sexual behaviourpheromonesattractionSex characteristicsPhysiologybehavior
researchProduct

Three beta-decaying states in 128In and 130In resolved for the first time using Penning-trap techniques

2020

Isomeric states in 128In and 130In have been studied with the JYFLTRAP Penning trap at the IGISOL facility. By employing state-of-the-art ion manipulation techniques, three different beta-decaying states in 128In and 130In have been separated and their masses measured. JYFLTRAP was also used to select the ions of interest for identification at a post-trap decay spectroscopy station. A new beta-decaying high-spin isomer feeding the isomer in 128Sn has been discovered in 128In at 1797.6(20) keV. Shell-model calculations employing a CD-Bonn potential re-normalized with the perturbative G-matrix approach suggest this new isomer to be a 16⁺ spin-trap isomer. In 130In, the lowest-lying (10⁻) isom…

Nuclear and High Energy PhysicsPenning trapAstronomy & Astrophysics01 natural sciencesIonPhysics Particles & Fieldsbeta-decay spectroscopyIsomersShell model0103 physical sciencesPhysics::Atomic and Molecular ClustersNuclear Experiment010306 general physicsSpectroscopyCouplingPhysicsScience & TechnologyNUCLEI010308 nuclear & particles physicsPhysicsPRECISION MASS-SPECTROMETRYNuclear shell modelR-PROCESSshell modelpenning trapRAMSEY METHODPenning traplcsh:QC1-999Physics NuclearExcited stateBeta (plasma physics)Physical SciencesSHELL-MODELTRANSITION-PROBABILITIESisomersAtomic physicsBeta-decay spectroscopylcsh:PhysicsIon cyclotron resonancePhysics Letters B
researchProduct

Regulating Internet Trade in CITES Species

2013

International trade in species that are or may be endangered by collection from the wild is regulated under the Convention on International Trade in Endangered Species of wild fauna and flora (CITES) for 176 member States (Parties). Internet commerce is a relatively new route for such trade. In 2007, the CITES Secretariat asked Parties to collect information on internet wildlife trade and report problems and implemented regulations. The reports indicated it was difficult to even approximate the influence of e-commerce on CITES-listed species (CITES Secretariat 2009). We report a case study in which we quantified international transactions over an internet auction site of CITES-listed cacti …

CactaceaeSettore BIO/07 - EcologiaConservation of Natural ResourcesInternationalityInternational tradeBiologyConference of the partiesmedia_common.cataloged_instanceEuropean unionTreatyEcology Evolution Behavior and SystematicsNature and Landscape Conservationmedia_commonInternetDiversityEcologyCITESEcologybusiness.industryEndangered SpeciesCommerceRange stateCITES Internet trade international Cactaceae cactiEnvironmental PolicyWildlife tradeSettore BIO/03 - Botanica Ambientale E ApplicataListing (finance)businessDatabase transaction
researchProduct

Galerucella nymphaeae (Col., Chrysomelidae) grazing increases Nuphar leaf production and affects carbon and nitrogen dynamics in ponds.

1990

The grazing effects of the waterlily beetle Galerucella nymphaeae on Nuphar lutea stands were studied in three ponds in Central Finland. Production of floating leaves of N. lutea and growth in the G. nymphaeae population were investigated in the ponds and bioenergetics of the beetle larvae in the laboratory. Combination of field and laboratory data enabled estimation of the effect of the beetle on the production of floating leaves of N. lutea and the consequences of grazing for the input of detritus from Nuphar into the ponds. Adults and larvae of G. nymphaeae consumed 3.0–6.1% of the net annual floating leaf production during the growing period. In addition to consumption losses, feeding a…

education.field_of_studyHerbivorebiologyAquatic ecosystemPopulationbiology.organism_classificationAgronomyAquatic plantBotanyGrazingNuphareducationNuphar luteaNitrogen cycleEcology Evolution Behavior and SystematicsOecologia
researchProduct