Search results for " confinement"

showing 10 items of 97 documents

Flexural behaviour of RC columns strengthened with steel angles and strips

2011

Settore ICAR/09 - Tecnica Delle CostruzioniRC columns strengthening confinement steel angles
researchProduct

Cyclic axial testing of columns confined with Fiber Reinforced Cementitious Matrix

2012

Settore ICAR/09 - Tecnica Delle CostruzioniRC columns; Confinement; FRC matrix; Experimental results; Cyclic testsCyclic testsExperimental resultsRC columns Confinement FRC matrix Experimental results Cyclic testsRC columnsFRC matrixConfinement
researchProduct

A simplified method for ductility calculation in RC jacketed columns

2015

Reinforced concrete (RC) jacketing is a common method to retrofit existing columns with poor structural performance. It can be applied in two different ways: if the continuity of the jacket is ensured, the axial load of the column can be transferred to the jacket, which will be directly loaded; conversely, if no continuity is provided, the jacket induces only confinement action. In both cases the strength and ductility evaluation is rather complex, due to the different physical phenomena included, such as confinement, composite action core-jacket, preload, buckling of longitudinal bars. Although different theoretical studies have been carried out to calculate the confinement effects, a prac…

Settore ICAR/09 - Tecnica Delle CostruzioniRC jacketingretrofitconfinementRC jacketing retrofit ductility confinement.ductilityconfinement.
researchProduct

An experimental study on the compressive behaviour of calcarenite masonry columns wrapped by fiber reinforced mortar wraps

2018

The use of Fiber Reinforced Cementitious Mortar (FRCM) systems for structural retrofitting of masonry structures has become increasingly popular in the last years, due to the capability of this technique in overcoming some of the drawbacks related to the adoption of resin-based composites. In fact, FRCM systems ensure good compatibility between the reinforcing layers and the substrate, achieving also the removability requirement, which is of fundamental importance for historical constructions. Recent research studies focused on the mechanical performance of FRCM materials, by studying its tensile behaviour and bond between the strengthening layer and masonry, pointing out as failure is alwa…

Settore ICAR/09 - Tecnica Delle CostruzioniStrengthening and repairExperimental studyStrengthening and repair; Experimental study; FRCM systems; Masonry; ConfinementStrengthening and repair Experimental study FRCM systems Masonry ConfinementMasonryFRCM systemsConfinement
researchProduct

Modelling steel jacketed RC columns: Remarks by experimental-numerical comparisons

2015

The recent large use of nonlinear seismic assessment techniques requires the definition of highly reliable computational models. The retrofitting or strengthening of RC columns by steel angles and battens is a commonly adopted technique, used to improve strength and deformation capacity of existing RC buildings. In the case of steel angles not directly loaded, the numerical definition of the cross-section model has to be handled carefully since it is affected by more uncertainties. The vertical load carried by the angles is a function of the lateral confinement pressure, the cohesion and the friction coefficient between the materials, parameters which are not always easy to predict. The pap…

Settore ICAR/09 - Tecnica Delle CostruzionicohesionconfinementOpenseesfrictionnumerical modellingOpensees confinement cohesion friction numerical modelling steel anglesCohesion friction numerical modelling steel angles opensees confinementsteel angles
researchProduct

PBO textile embedded in FRCM for confinement of r.c. columns

2014

Results of experimental tests on two reinforced concrete columns confined with PBO-FRCM jacketing subject to axial load and bending moments are presented, showing the effectiveness of the confinement system. Comparison of test results against theoretical results derived by a fiber model stress the ability of the confinement system to enhance both strength and deformation capacity of the confined concrete

Settore ICAR/09 - Tecnica Delle Costruzionir.c. confinement flexural ductility FRCM PBO fiber.
researchProduct

Quantum confinement effects observed by the photoluminescence of SiOx/SiO2 multilayers

2012

Spectral and decay features related to the red emission from Si nanocrystals were investigated by time-resolved photoluminescence spectra carried out on SiOx/SiO2 nanosized multilayers. On decreasing the SiOx thickness from 8.4 nm to 2.2 nm this luminescence band exhibits a blue-shift from 1.65 eV to 1.75 eV and its lifetime increases from 12μs to 17 μs. These results are discussed on the basis of previous models proposed in literature and agree with quantum confinement effects arising from differently sized Si nanocrystals in our samples.

SiOx/SiO2 mulilayers Si nanocrystal quantum confinement time-resolved photoluminescence
researchProduct

Experimental investigation on BFRCM confinement of masonry cylinders and comparison with BFRP system

2021

Abstract Fabric reinforced cementitious mortar (FRCM) materials have started to be employed during the last years with the aim of overcoming the drawbacks related to the use of fibre reinforced polymer (FRP) composites, proving to be potentially suitable for strengthening masonry structures. Moreover, the will to develop materials able to guarantee a certain degree of sustainability without renouncing to adequate mechanical properties has drawn the attention to the use of basalt fibres, which appear to be a valid alternative to carbon or glass fibres. This work presents an experimental investigation on a basalt FRCM (BFRCM) system to confine circular masonry columns, aimed at evaluating the…

Strengthening and repairDigital image correlationTextileMaterials scienceDigital image correlation (DIC)0211 other engineering and technologiesUniaxial compression020101 civil engineering02 engineering and technology0201 civil engineering021105 building & constructionBasalt FRCM Confinement Digital image correlation (DIC) Masonry cylinders Strengthening and repairGeneral Materials ScienceMasonry cylindersBasalt FRCMCivil and Structural Engineeringbusiness.industryBuilding and ConstructionStructural engineeringFibre-reinforced plasticMasonrySettore ICAR/09 - Tecnica Delle CostruzioniClay brickCementitiousMortarbusinessConfinement
researchProduct

Printing Life-Inspired Subcellular Scale Compartments with Autonomous Molecularly Crowded Confinement.

2019

A simple, rapid, and highly controlled platform to prepare life-inspired subcellular scale compartments by inkjet printing has been developed. These compartments consist of fL-scale aqueous droplets (few µm in diameter) incorporating biologically relevant molecular entities with programmed composition and concentration. These droplets are ink-jetted in nL mineral oil drop arrays allowing for lab-on-chip studies by fluorescence microscopy and fluorescence life time imaging. Once formed, fL-droplets are stable for several hours, thus giving the possibility of readily analyze molecular reactions and their kinetics and to verify molecular behavior and intermolecular interactions. Here, this pla…

Surface PropertiesDNA hairpinBiomedical EngineeringGeneral Biochemistry Genetics and Molecular BiologyFluorescenceBiomaterialsSettore CHIM/01molecular crowdingbiomolecular confinementlife-like compartmentFluorescence microscopeInkjet printinginkjet printingBiochemistry Genetics and Molecular Biology (all)ChemistryDrop (liquid)Intermolecular forceLife timeDNABiomaterialFluorescencebiomolecular confinement; DNA hairpins; inkjet printing; life-like compartments; molecular crowdingDNA hairpinslife-like compartmentsPrinting Three-DimensionalBiophysicsMolecular probeAdvanced biosystems
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct