Search results for " electronics"

showing 10 items of 580 documents

Halogen Bonds in 2,5-Dihalopyridine-Copper(I) Halide Coordination Polymers

2019

Two series of 2,5-dihalopyridine-Cu(I)A (A = I, Br) complexes based on 2-X-5-iodopyridine and 2-X-5-bromopyridine (X = F, Cl, Br and I) are characterized by using single-crystal X-ray diffraction analysis to examine the nature of C2&minus

pyridinedihalopyridineSupramolecular chemistrychemistry.chemical_elementHalidekupari010402 general chemistry01 natural scienceslcsh:TechnologyArticlechemistry.chemical_compoundkemialliset sidoksetPyridineGeneral Materials Sciencelcsh:Microscopypolymeeritlcsh:QC120-168.85chemistry.chemical_classificationHalogen bondlcsh:QH201-278.5010405 organic chemistrylcsh:TPolymerkompleksiyhdisteetCopper3. Good health0104 chemical sciencesCrystallographyhalopyridineschemistrylcsh:TA1-2040copperHalogenFluorinehalogeenisidoksetlcsh:Descriptive and experimental mechanicshalogen bondlcsh:Electrical engineering. Electronics. Nuclear engineeringlcsh:Engineering (General). Civil engineering (General)lcsh:TK1-9971
researchProduct

The Experimental Study of Heat Waste Conversion into Useful Electric Power

2009

This paper presents the practical results ofthe design solutions, executing and experimentaltesting of a prototype model of o thermoelectricgenerator, based on the conversion of residualthermical energy into electric power, by improving theSeebeck effect. To this purpose, high performancethermoelectric modules have been used, taken from therecent production of the American Corporation Hi-ZTechnology. The prototype thermoelectric generatorbuilt for a demonstrative purposes has got the lowefficiency category. The results taken from the testsand experimental measurements have showntheimportance of the constructive solution of materialsand technologies that have been used. These resultsdirect t…

recoveryreconversion.Seebeck Coefficientthermoelectric modulelcsh:Electrical engineering. Electronics. Nuclear engineeringfigure of meritlcsh:TK1-9971performance coefficientJournal of Electrical and Electronics Engineering
researchProduct

Impact Evaluation of Innovative Selective Harmonic Mitigation Algorithm for Cascaded H-Bridge Inverter on IPMSM Drive Application

2021

This paper presents a detailed analysis of the use of a novel Harmonic Mitigation algorithm for Cascaded H-Bridge Multilevel Inverter in electrical drives for the transportation field. For this purpose, an enhanced mathematical model of Interior Permanent Magnet Synchronous Motor (IPMSM), that takes into account simultaneously saturation, cross-coupling, spatial harmonics, and iron loss effects, has been used. In detail, this model allows estimating accurately the efficiency and the torque ripple of the IPMSM, crucial parameters for transportation applications. Moreover, two traditional pulse width modulation strategies, Sinusoidal Phase-Shifted and Switching Frequency Optimal Phase-Shifted…

selective harmonic mitigation algorithmComputer scienceImpact evaluationHarmonic mitigationSettore ING-IND/32 - Convertitori Macchine E Azionamenti ElettriciCascaded H-bridge multilevel inverter (CHBMI)torque rippleH bridge inverterTK1-9971Settore ING-IND/31 - ElettrotecnicaefficiencyElectronic engineeringCascaded H-bridge multilevel inverter (CHBMI) efficiency interior permanent magnet synchronous machine (IPMSM) selective harmonic mitigation algorithm torque rippleElectrical engineering. Electronics. Nuclear engineeringinterior permanent magnet synchronous machine (IPMSM)IEEE Open Journal of Industry Applications
researchProduct

Influence of a Thiolate Chemical Layer on GaAs (100) Biofunctionalization: An Original Approach Coupling Atomic Force Microscopy and Mass Spectrometr…

2013

International audience; Widely used in microelectronics and optoelectronics; Gallium Arsenide (GaAs) is a III-V crystal with several interesting properties for microsystem and biosensor applications. Among these; its piezoelectric properties and the ability to directly biofunctionalize the bare surface, offer an opportunity to combine a highly sensitive transducer with a specific bio-interface; which are the two essential parts of a biosensor. To optimize the biorecognition part; it is necessary to control protein coverage and the binding affinity of the protein layer on the GaAs surface. In this paper; we investigate the potential of a specific chemical interface composed of thiolate molec…

self-assembled thiolate monolayersMaterials scienceAnalytical chemistryproteins grafting02 engineering and technology010402 general chemistryMass spectrometrylcsh:Technology01 natural sciencesArticleGallium arsenideGaAs; self-assembled thiolate monolayers; proteins grafting; AFM; MALDI-TOF MSchemistry.chemical_compoundMonolayerMALDI-TOF MSMoleculeMicroelectronicsGeneral Materials Science[SPI.NANO]Engineering Sciences [physics]/Micro and nanotechnologies/Microelectronicslcsh:Microscopylcsh:QC120-168.85lcsh:QH201-278.5lcsh:Tbusiness.industryGaAs021001 nanoscience & nanotechnology0104 chemical sciencesMatrix-assisted laser desorption/ionizationchemistryChemical engineeringlcsh:TA1-2040Docking (molecular)lcsh:Descriptive and experimental mechanics[ SPI.NANO ] Engineering Sciences [physics]/Micro and nanotechnologies/Microelectronicslcsh:Electrical engineering. Electronics. Nuclear engineeringAFMlcsh:Engineering (General). Civil engineering (General)0210 nano-technologybusinesslcsh:TK1-9971BiosensorMaterials
researchProduct

A Channel-Aware Adaptive Modem for Underwater Acoustic Communications

2021

Acoustic underwater channels are very challenging, because of limited bandwidth, long propagation delays, extended multipath, severe attenuation, rapid time variation and large Doppler shifts. A plethora of underwater communication techniques have been developed for dealing with such a complexity, mostly tailoring specific applications scenarios which can not be considered as one-size-fits-all solutions. Indeed, the design of environment-specific solutions is especially critical for modulations with high spectral efficiency, which are very sensitive to channel characteristics. In this paper, we design and implement a software-defined modem able to dynamically estimate the acoustic channel c…

software radioGeneral Computer ScienceSettore ING-INF/03 - TelecomunicazioniOrthogonal frequency-division multiplexingComputer scienceBandwidth (signal processing)General EngineeringChannel estimationData_CODINGANDINFORMATIONTHEORYChannel estimation JANUS modems OFDM software radio underwater communication watermarkTK1-9971Delay spreadmodemsJANUSInterference (communication)underwater communicationModulationElectronic engineeringGeneral Materials ScienceElectrical engineering. Electronics. Nuclear engineeringUnderwater acoustic communicationMultipath propagationOFDMCommunication channelIEEE Access
researchProduct

Sonication-Induced Modification of Carbon Nanotubes: Effect on the Rheological and Thermo-Oxidative Behaviour of Polymer-Based Nanocomposites.

2018

The aim of this work is the investigation of the effect of ultrasound treatment on the structural characteristics of carbon nanotubes (CNTs) and the consequent influence that the shortening induced by sonication exerts on the morphology, rheological behaviour and thermo-oxidative resistance of ultra-high molecular weight polyethylene (UHMWPE)-based nanocomposites. First, CNTs have been subjected to sonication for different time intervals and the performed spectroscopic and morphological analyses reveal that a dramatic decrease of the CNT's original length occurs with increased sonication time. The reduction of the initial length of CNTs strongly affects the nanocomposite rheological behavio…

sonicationMaterials scienceCNTs; Nanocomposites; Rheology; Sonication; Thermo-oxidative stability; UHMWPE; Materials Science (all)SonicationUHMWPE02 engineering and technologyCarbon nanotube010402 general chemistry01 natural scienceslcsh:TechnologyArticlelaw.inventionchemistry.chemical_compoundUHMWPE; CNTs; sonication; nanocomposites; rheology; thermo-oxidative stabilityThermal conductivityRheologylawnanocompositesthermo-oxidative stabilityGeneral Materials Sciencelcsh:Microscopylcsh:QC120-168.85chemistry.chemical_classificationNanocompositeCNTslcsh:QH201-278.5lcsh:TPolymerPolyethylene021001 nanoscience & nanotechnology0104 chemical scienceschemistryChemical engineeringlcsh:TA1-2040Interphaselcsh:Descriptive and experimental mechanicsrheologylcsh:Electrical engineering. Electronics. Nuclear engineeringMaterials Science (all)0210 nano-technologylcsh:Engineering (General). Civil engineering (General)lcsh:TK1-9971Materials (Basel, Switzerland)
researchProduct

Theoretical study of systems with interest in molecular magnetism and electronics

2013

The project described in this thesis is motivated by a particular interest in Molecular Magnetism from a theoretical point of view. Molecular Magnetism, is still a thriving research field where some problems remain unexplored: A large amount of molecular systems are still theoretically unmanageable due to their huge computational requirements, while the standard software package cannot profit from the power of multiprocessor supercomputers. The scientific community would require a computational code to calculate the magnetic properties of mixed-valence clusters. A new magnetic POM, which needs only one magnetic ion to behave as SMMs, has appeared. A rationalization of its behaviour and an e…

spintronicsmolecular electronicsUNESCO::QUÍMICAmolecular magnetismUNESCO::QUÍMICA::Química inorgánica::Tierras rarasnanoscience:QUÍMICA [UNESCO]:QUÍMICA::Química inorgánica::Tierras raras [UNESCO]
researchProduct

Tuning of Emission Wavelength of CaS:Eu by Addition of Oxygen Using Atomic Layer Deposition

2021

| openaire: EC/H2020/820423/EU//S2QUIP | openaire: EC/H2020/834742/EU//ATOP | openaire: EC/H2020/965124/EU//FEMTOCHIP Atomic layer deposition (ALD) technology has unlocked new ways of manipulating the growth of inorganic materials. The fine control at the atomic level allowed by ALD technology creates the perfect conditions for the inclusion of new cationic or anionic elements of the already-known materials. Consequently, novel material characteristics may arise with new functions for applications. This is especially relevant for inorganic luminescent materials where slight changes in the vicinity of the luminescent centers may originate new emission properties. Here, we studied the lumines…

sulfiditkalsiumTechnologyMicroscopyQC120-168.85Eu [CaS]TQH201-278.5CaS:Eu; phosphor; photoluminescence; atomic layer depositionatomikerroskasvatusharvinaiset maametallitEngineering (General). Civil engineering (General)ArticlephosphorTK1-9971Descriptive and experimental mechanicsatomic layer depositionCaS:EuphotoluminescenceElectrical engineering. Electronics. Nuclear engineeringohutkalvotTA1-2040fotoluminesenssifosforiMaterials
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Thermo-Mechanical Behaviour of Flax-Fibre Reinforced Epoxy Laminates for Industrial Applications

2015

The present work describes the experimental mechanical characterisation of a natural flax fibre reinforced epoxy polymer composite. A commercial plain woven quasi-unidirectional flax fabric with spun-twisted yarns is employed in particular, as well as unidirectional composite panels manufactured with three techniques: hand-lay-up, vacuum bagging and resin infusion. The stiffness and strength behaviours are investigated under both monotonic and low-cycle fatigue loadings. The analysed material has, in particular, shown a typical bilinear behaviour under pure traction, with a knee yield point occurring at a rather low stress value, after which the material tensile stiffness is significantly r…

tensile propertieWork (thermodynamics)Materials scienceflax fibre compositemedicine.medical_treatmentcrimped unidirectional textilesComposite numbercrimped unidirectional textileflax fibre composite; tensile properties; crimped unidirectional textiles; damage; IR thermography; thermoelastic stress analysislcsh:TechnologyArticleSettore ING-IND/14 - Progettazione Meccanica E Costruzione Di MacchineThermoelastic dampingUltimate tensile strengthmedicineGeneral Materials ScienceComposite materialSettore ING-IND/15 - Disegno E Metodi Dell'Ingegneria Industrialelcsh:Microscopylcsh:QC120-168.85tensile propertieslcsh:QH201-278.5lcsh:Tthermoelastic stress analysisStiffnessEpoxyTraction (orthopedics)IR thermographylcsh:TA1-2040visual_artThermographyvisual_art.visual_art_mediumlcsh:Descriptive and experimental mechanicslcsh:Electrical engineering. Electronics. Nuclear engineeringmedicine.symptomlcsh:Engineering (General). Civil engineering (General)lcsh:TK1-9971damageMaterials
researchProduct