Search results for " expression"

showing 10 items of 4731 documents

Maturation of Epidermal Langerhans Cells In Vitro Is Accompanied by Downregulation of 4F2 (CD98) as Determined by Differential Display

1998

Following short-term culture, Langerhans cells mature morphologically and functionally into potent immunostimulatory cells. As regulation of gene expression accompanies this maturation process, it is likely that differentially expressed genes are involved in the maturation events. Using the recently described method of differential display, we generated cDNA expression patterns starting with mRNA of murine epidermal Langerhans cells isolated either directly (fLC) or following 3 d cultivation (cLC). Five hundred putative differentially expressed cDNA fragments were recovered from the gel. For a part of the fragments differential expression was confirmed by dot blot and Southern hybridization…

skinLangerhans cellDNA ComplementaryDown-RegulationFusion Regulatory Protein-1GrowthDermatologyBiologyBiochemistryMiceDownregulation and upregulationAntigens CDComplementary DNAmedicineAnimalsRNA MessengerCloning Moleculardifferential gene expressionGeneMolecular BiologySouthern blotRegulation of gene expressionJNK2Differential displayMice Inbred BALB Cepidermal cellsGene Expression Regulation DevelopmentalCell BiologyMolecular biologyMice Inbred C57BLmedicine.anatomical_structureGenesCell cultureLangerhans CellsAntigens SurfaceCarrier ProteinsSequence AnalysisJournal of Investigative Dermatology
researchProduct

The oxidative capacity of skeletal muscle : effects of genotype, high-fat diet and physical activity

2016

sopeutuminenmitochondrial biogenesisrasvatexerciselihaksetliikuntafysiologiaadaptationhiiretruokavaliotgenotyyppiangiogenesishigh-fat dietgene expressionmetabolinen oireyhtymäfyysinen aktiivisuushapenotto
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

ALS-RELATED FUS PROTEIN IS MISLOCALIZED TO CYTOPLASM AND RECRUITED INTO STRESS GRANULES IN FIBROBLASTS OF ASYMPTOMATIC FUS P525L MUTATION CARRIERS

Symptoms onset in Amyotrophic Lateral Sclerosis (ALS) occur when over 70% of motor neurons is already lost, suggesting a relatively long pre-symptomatic phase. The description of several genes linked to ALS (e.g., SOD1, FUS, TARDP, C9orf72) has now allowed identification of pre-symptomatic carriers. These pre-symptomatic (or even preclinical) carriers can be followed up with the aim to identify the very early clinical disease-related changes or a valuable biomarker. These efforts seem at present the best approach for the implementation of an early symptomatic therapy or for the disease prevention. In this work, we studied the expression of FUS protein in cultured skin fibroblasts from pre-s…

stress granuleshuman fibroblastsFUS P525L carriersSettore MED/26 - NeurologiaALScytoplasmic FUS expressionSettore BIO/09 - Fisiologia
researchProduct

Comparative transcriptomics of albino and warningly‐coloured caterpillars

2021

Abstract Coloration is perhaps one of the most prominent adaptations for survival and reproduction of many taxa. Coloration is of particular importance for aposematic species, which rely on their coloring and patterning acting as a warning signal to deter predators. Most research has focused on the evolution of warning coloration by natural selection. However, little information is available for color mutants of aposematic species, particularly at the genomic level. Here, I compare the transcriptomes of albino mutant caterpillars of the aposematic wood tiger moth (Arctia plantaginis) to those of their full sibs having their distinctive orange‐black warning coloration. The results showed >29…

suojautuminenvaroitusväri0106 biological sciencesZoologyContext (language use)Aposematismmelaniinit010603 evolutionary biology01 natural sciencesPredationMelanin03 medical and health sciencesmedicineaposematismgeeniekspressioArctia plantaginisCaterpillarGeneQH540-549.5Ecology Evolution Behavior and SystematicsOriginal Research030304 developmental biologyNature and Landscape Conservation0303 health sciencesgeenitNatural selectionEcologybiologyfungimedicine.diseasebiology.organism_classificationmelaninalbinismigene expressionAlbinismEcology and Evolution
researchProduct

Estimating Stress in Online Meetings by Remote Physiological Signal and Behavioral Features

2022

Work stress impacts people’s daily lives. Their well-being can be improved if the stress is monitored and addressed in time. Attaching physiological sensors are used for such stress monitoring and analysis. Such approach is feasible only when the person is physically presented. Due to the transfer of the life from offline to online, caused by the COVID-19 pandemic, remote stress measurement is of high importance. This study investigated the feasibility of estimating participants’ stress levels based on remote physiological signal features (rPPG) and behavioral features (facial expression and motion) obtained from facial videos recorded during online video meetings. Remote physiological sign…

sykeremote photoplethysmographyhead poseetäseurantakatseenseurantastress estimationstressisykemittaritilmeeteye gazefacial expressionetäkokouksetpsykofysiologiaProceedings of the 2022 ACM International Joint Conference on Pervasive and Ubiquitous Computing
researchProduct

Hysteretic Systems Subjected to Delta Correlated Input

1994

The paper deals with the evaluation of the probabilistic response of a single degree of freedom elastic-perfectly plastic system subjected to a delta correlated input process. The probabilistic characterisation of the response is here obtained by considering the accumulated plastic deformations as a compound homogeneous Poisson process independent of the external input. In this case the former can be considered as an external noise acting on the linear system. A closed form solution is also obtained and the analytic expression is compared with the customary Monte-Carlo method.

symbols.namesakeAnalytical expressionsMathematical analysisLinear systemsymbolsProbabilistic logicProcess (computing)Poisson processExternal noiseClosed-form expressionSingle degree of freedomMathematics
researchProduct

Computing the Trace

2001

So far we have been interested in the general expression for the WKB-propagation function. Now we turn our attention to the trace of that propagator, since we want to exhibit the energy eigenvalues of a given potential. From earlier discussions we know that the energy levels of a given Hamiltonian are provided by the poles of the Green’s function:

symbols.namesakeTheoretical physicsComputer sciencesymbolsPropagatorStationary phase approximationGeneral expressionHamiltonian (quantum mechanics)Eigenvalues and eigenvectors
researchProduct

Emotional user experience and feeling of control

2015

Current research on emotional user experience lacks a clear exposition on the relationship between feeling of control and the emotion response. The appraisal theory of emotion posits that perceived control over an event is an important factor in determining the emotional response to the event. It is therefore hypothesised, that the relationship between emotional experiences and interaction events is mediated by feeling of control. In an experiment (N = 38), participants used a joystick to control game objects, and gave self-reports of their emotional states and feeling of control. Pathway analyses predicting the factors of emotional experience with event logs reveal that feeling of control …

ta113business.industrymedia_common.quotation_subjectemotionEmotion workAppraisal theoryfeeling of controlPAD emotional state modelFeelingUser experience designuser experienceEmotional expressionPsychologybusinessEmotional exhaustionSocial psychologyCompetence (human resources)ta515media_common
researchProduct

Contraintes et libertés textuelles

2006

The article starts from a conception of language according to which the semiotic units that speakers use do not emanate from individual mental processes but from the socialization of representation instruments which, being individual elements initially, have later been involved in processes of communicative circulation. In the same way that, in each language, verbal uses are limited by a series of restrictions in the constitution of some phonic, lexical or morphosyntactic structures, there are also some other constraints that affect textual genres. This means that these are the product of the history of the uses of language and that they work at a praxeologic level. These ideas apply to the…

textual Restrictionslcsh:Language and LiteratureUNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASLingüísticaFilologíasgenre Types (genres des texts)Sciences du langagePraxeologylcsh:Philology. LinguisticsLinguistiqueliterary WorkSémiologie (généralités)Narrativeddc:370lcsh:P1-1091textual FreedomsType of speeches:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]Expression of Temporalitylcsh:Pgenre Types (genres des texts); Type of speeches; textual Restrictions; textual Freedoms; Narrative; Praxeology; Expression of Temporality; literary WorkAnalyse des textes et des discoursCaplletra: Revista Internacional de Filologia
researchProduct