Search results for " format"

showing 10 items of 2156 documents

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

The increase in maternal expression of axin1 and axin2 contribute to the zebrafish mutant ichabod ventralized phenotype.

2014

β-Catenin is a central effector of the Wnt pathway and one of the players in Ca(+)-dependent cell-cell adhesion. While many wnts are present and expressed in vertebrates, only one β-catenin exists in the majority of the organisms. One intriguing exception is zebrafish that carries two genes for β-catenin. The maternal recessive mutation ichabod presents very low levels of β-catenin2 that in turn affects dorsal axis formation, suggesting that β-catenin1 is incapable to compensate for β-catenin2 loss and raising the question of whether these two β-catenins may have differential roles during early axis specification. Here we identify a specific antibody that can discriminate selectively for β-…

axin1axin2zebrafish mutant ichabodMessengerEmbryonic DevelopmentBiochemistryBETA-CATENINAxin2-RGS DOMAINAxin ProteinAntibody SpecificitySettore BIO/10 - BiochimicaAnimalsAxin2-RGS DOMAIN; AXIS FORMATION; BETA-CATENIN; Wnt signaling; ZEBRAFISH; Animals; Antibody Specificity; Axin Protein; Blastula; Cell Nucleus; Embryonic Development; Female; Gene Expression Regulation Developmental; Genes Dominant; Immunohistochemistry; Lithium Chloride; Mutation; Phenotype; Protein Stability; Protein Transport; RNA Messenger; Signal Transduction; Up-Regulation; Zebrafish; Zebrafish Proteins; beta Catenin; Biochemistry; Cell Biology; Molecular BiologyDevelopmentalDominantRNA MessengerMolecular BiologyZebrafishbeta CateninGenes DominantAXIS FORMATIONCell NucleusProtein StabilityGene Expression Regulation DevelopmentalCell BiologyBlastulaZebrafish ProteinsWnt signalingImmunohistochemistryUp-RegulationProtein TransportPhenotypeGene Expression RegulationGenesMutationRNAFemaleLithium ChlorideSignal Transduction
researchProduct

Novel Sortase A (SrtA) inhibitors interfere with the formation of staphylococcal biofilms

2013

Staphylococcus aureus, due to its wide arsenal of virulence factors, is a very versatile pathogen responsible for a wide variety of infectious diseases. The virulence factors include the cell-wall associated proteins that have a direct role in the first stage of pathogenesis. The Sortase A (SrtA) transpeptidase is responsible for covalent anchoring to the cell wall of various surface proteins and it is considered a good target to design new antivirulence agents. In this study, we report the identification of an inhibitor of SrtA afforded from the random screening of a small molecular library of around 150 synthetic compounds, through a high throughput assay by using the standard Dabcyl-QALP…

biofilm formation staphylococcal biofilm Sortase A
researchProduct

Interhemispheric connections through the pallial commissures in the brain ofPodarcis hispanicaandGallotia stehlinii(Reptilia, Lacertidae)

1990

The cells-of-origin and the mode and site of termination of the interhemispheric connections passing through the anterior and posterior pallial commissures in the telencephalon of two lizards (Podarcis hispanica and Gallotia stehlinii) were investigated by studying the anterograde and retrograde transport of unilaterally injected horseradish peroxidase. The commissural projections arise mainly from pyramidal cells in the medial, dorsomedial, and dorsal cortices (medial subfield). Additionally some non-pyramidal neurons in the medial and dorsal cortices contribute to the commissural system. Medial cortex neurons project to the contralateral anterior septum through the anterior pallial commis…

biologyCerebrumMedial cortexAnatomyHippocampal formationCommissurebiology.organism_classificationPodarcis hispanicamedicine.anatomical_structureCortex (anatomy)Cerebral hemispheremedicineAxoplasmic transportAnimal Science and ZoologyDevelopmental BiologyJournal of Morphology
researchProduct

Neuronal circuitry in the medial cerebral cortex of lizards

1997

The medial cortex of lizards is a simple three-layered brain region displaying many characteristics which parallel the hippocampal fascia dentata of mammals. Its principal neurons form a morphologically diverse population, partly as a result of the prominent continuous growth of this nervous centre. By using the classical Golgi impregnation method we describe here the morphology of the principal neurons (8 types) and the short-axon interneurons (18 types) populating the medial cortex of Podarcis hispanica as well as the connections between them.

biologyCerebrumMedial cortexOuter plexiform layerHippocampal formationbiology.organism_classificationPodarcis hispanicaNeuronal circuitrymedicine.anatomical_structurenervous systemCerebral cortexmedicineFascia dentataNeuroscience
researchProduct

A new strategy in selecting oocytes using cumulus cells analysis of specific molecules of the apoptotic pathway, according to the ability to reach bl…

2015

Study question: The aim of the research was to investigate the apoptosis rate of individual cumulus cell–oocyte complexes (COC), associated to the level of p-Akt, to verify the difference between oocytes who produce embryos able to reach the blastocyst stage compared with embryos arrested during the in vitro colture. Summary answer: It was demonstrated that DNA fragmentation in cumulus cells was remarkably lower in patients who achieved a pregnancy after ICSI cycles, related to the quality of oocytes and embryos. Akt pathway plays a critical role in the regulation of cell survival, and most growth factors activate this pathway. What is known already: Studies on oocyte maturation have shown …

blastocyst formationp AKTSettore BIO/06 - Anatomia Comparata E Citologiaapoptosicleavage arrest
researchProduct

Influence of MeV H+ ion beam flux on cross-linking and blister formation in PMMA resist

2012

In soft lithography, a pattern is produced in poly(dimethylsiloxane) (PDMS) elastomer by casting from a master mould. The mould can be made of poly(methylmethacrylate) (PMMA) resist by utilising either its positive or negative tone induced by an ion beam. Here we have investigated the irradiation conditions for achieving complete cross-linking and absence of blister formation in PMMA so that its negative characteristic can be used in making master moulds. PMMA thin films approximately 9 µm thick on Si were deposited by spin coating. The 2-MeV H+ ion beam was generated using a 1.7-MV tandem Tandetron accelerator. The beam was collimated to a 500×500 µm2 cross section using programmable proxi…

blister formationlcsh:Tlcsh:Technology (General)soft lithographylcsh:T1-995lcsh:QH+ ion irradiationPMMA resistlcsh:Sciencelcsh:Science (General)lcsh:Technologylcsh:Q1-390Maejo International Journal of Science and Technology
researchProduct

Palladium-catalyzed heteroaryl thioethers synthesis overcoming palladium dithiolate resting states inertness: Practical road to sulfones and NH-sulfo…

2018

International audience; We provide efficient synthetic access to heteroaryl sulfones in two-steps using a simple palladium-1,1'-bis [(diphenyl)phosphanyl]ferrocene catalyst to form in high yields variously functionalized heteroaromatic thioethers. Pyridinyl-containing substrates can be subsequently selectively oxidized into sulfones and NH-sulfoximines by using very mild oxidation conditions with a high functional group tolerance. In the palladium catalyzed C-S coupling of heteroaromatic thiols, reactivity limitation is attached with electron-deficient thiols. We show that this limitation can be resolved by the successful use of 2-bromoheteroarenes in the C-S coupling. We established herein…

bond formationarenessulfideschemistry.chemical_element010402 general chemistry01 natural sciencesCatalysisefficientCatalysischemistry.chemical_compounds-arylation[CHIM]Chemical SciencesReactivity (chemistry)SulfonesResting statethiols[PHYS]Physics [physics]010405 organic chemistryProcess Chemistry and TechnologyGeneral Chemistryindolesacid saltsCombinatorial chemistry0104 chemical sciencesThiolatesC-S couplingchemistryFerroceneNH-sulfoximinesReagentElectrophileFunctional groupH functionalizationdirecting groupPalladiumStoichiometryPalladiumCatalysis Communications
researchProduct

Modelling of Final Plastic Deformation in the Case of Continuous Straight-Edged Oblique Cutting

1992

This paper presents a complex oblique cutting model for the case of varying chip formation conditions and its practical application in relation to the results of degree of final plastic deformation in the primary shear zone is considered. A computer procedure for prediction of the shear angle is given and the place of the oblique cutting process among the results obtained previously is established.

business.industryChip formationProcess (computing)Oblique cuttingShear angleStructural engineeringShear zonebusinessGeology
researchProduct

A model study for the progressive disruption of CA1 firing properties during Alzheimer’s disease

2011

Several independent studies show that β-Amyloid (Aβ) peptides accumulation, one of the characteristic hallmark of Alzheimer’s Disease (AD), can affect the normal neuronal activity in different ways causing an increase or a decrease in neuronal membrane excitability. For example, experimental evidence for a negative impact on neuronal membrane in animal models of AD has been obtained in dual patch recordings in rat hippocampal tissue slices, in which Aβ blocked K channels in pyramidal cell dendrites, causing an increase in dendritic membrane excitability. The resulting increased Ca2+ influx and excitoxicity may lead to dendritic degeneration. However, further experimental evidence suggests t…

business.industryMechanism (biology)General NeuroscienceCelllcsh:QP351-495DiseaseDegeneration (medical)Hippocampal formationlcsh:RC321-571Cellular and Molecular Neurosciencemedicine.anatomical_structurelcsh:Neurophysiology and neuropsychologyPoster PresentationMedicinePremovement neuronal activityNeuronPyramidal cellbusinessNeurosciencelcsh:Neurosciences. Biological psychiatry. NeuropsychiatryBMC Neuroscience
researchProduct