Search results for " tolerance"

showing 10 items of 760 documents

Latest Developments and Results of Radiation Tolerance CMOS Sensors with Small Collection Electrodes

2020

The development of radiation hard Depleted Monolithic Active Pixel Sensors (DMAPS) targets the replacement of hybrid pixel detectors to meet radiation hardness requirements of at least 1.5e16 1 MeV neq/cm2 for the HL-LHC and beyond. DMAPS were designed and tested in the TJ180 nm TowerJazz CMOS imaging technology with small electrodes pixel designs. This technology reduces costs and provides granularity of 36.4x36.4 um2 with low power operation (1 uW/pixel), low noise of ENC < 20 e-, a small collection electrode (3 um) and fast signal response within 25 ns bunch crossing. This contribution will present the latest developments after the MALTA and Mini-MALTA sensors. It will illustrate the imp…

noiseParticle tracking detectors ; Radiation-hard detectors ; Electronic detector readout concepts ; CMOS sensors ; Monolithic active pixel sensorsMaterials science010308 nuclear & particles physicsbusiness.industryintegrated circuitelectrode01 natural sciencesCMOSRadiation toleranceefficiency0103 physical sciencesElectrodeHardware_INTEGRATEDCIRCUITSelectronics: readoutOptoelectronicssemiconductor detector[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]Detectors and Experimental Techniquescontrol system010306 general physicsbusiness
researchProduct

High-Fat Diet Induces Pre-Diabetes and Distinct Sex-Specific Metabolic Alterations in Negr1-Deficient Mice

2021

In the large GWAS studies, NEGR1 gene has been one of the most significant gene loci for body mass phenotype. The purpose of the current study was to clarify the role of NEGR1 in the maintenance of systemic metabolism, including glucose homeostasis, by using both male and female Negr1−/− mice receiving a standard or high fat diet (HFD). We found that 6 weeks of HFD leads to higher levels of blood glucose in Negr1−/− mice. In the glucose tolerance test, HFD induced phenotype difference only in male mice

obesitymedicine.medical_specialtyQH301-705.5Medicine (miscellaneous)BiologyArticleGeneral Biochemistry Genetics and Molecular Biologychemistry.chemical_compoundDownregulation and upregulationgenetic modelsInternal medicineGenetic modelmedicineGlucose homeostasisBiology (General)Fatty acid synthesisGlucose tolerance testmedicine.diagnostic_testnutritional and metabolic diseasesMetabolismmetabolic diseasemetabolomicsNegr1Protein catabolismEndocrinologyglucose intoleranceGluconeogenesischemistry<i>Negr1</i>Biomedicines
researchProduct

Correlation of Metabolic Syndrome with Redox Homeostasis Biomarkers: Evidence from High-Fat Diet Model in Wistar Rats

2022

Metabolic Syndrome (MetS) is an extremely complex disease. A non-balanced diet such as high-fat diet (HFD) induces metabolic dysfunction that could modify redox homeostasis. We here aimed at exploring redox homeostasis in male Wistar rats, following 8 weeks of HFD, correlating the eventual modification of selected biomarkers that could be associated with the clinical manifestations of MetS. Therefore, we selected parameters relative to both the glucose tolerance and lipid altered metabolism, but also oxidative pattern. We assessed some biomarkers of oxidative stress i.e., thiols balance, lipid peroxidation and antioxidant barriers, via the use of specific biochemical assays, individuating e…

oxidative streglucose toleranceSettore BIO/16 - Anatomia UmanaPhysiologyClinical Biochemistrynon-alcoholic fatty liver diseaseCell BiologySettore BIO/09 - FisiologiaBiochemistryoxidative stress; anti-oxidant barriers; glucose tolerance; lipid metabolism; non-alcoholic fatty liver disease; adipose tissue distributionanti-oxidant barrierlipid metabolismMolecular Biologyadipose tissue distributionAntioxidants
researchProduct

When other rules defend dissidents : the situation of Protestants and Orthodox Christians in the Polish - Lithuanian Commonwealth of the Saxon era

2018

The article address the problem of limiting the rights of Protestants and other non-Catholic Christian denominations during the reigns of two kings from the Wettin dynasty - King Augustus II (1697-1733). The process started as early as the second half of the 17th century, but it was fully accomplished in the years 1717-1736. In the article the author discussed the resolutions of the sejms and other legal acts introduced at that time, the aim of which was to eliminate dissenters from public life. The Polish monarchs were inert towards the process. It was the rulers of non - Catholic European states (Prussia, Russia and Great Britain) that helped Protestants an Orthodox Christans in Poland

prawosławiethe worship of the Blessen Virgin Mary and the saintsThe 18th centuryCatholicismthe Polish - Lithuanian CommonwealthProtestantismXVIII wiekOrthodoxyRzeczpospolita Obojga Narodówtolerancja i nietolerancja religijnakatolicyzmprotestantyzmkult maryjny i świętychreligious tolerance and intoleranceBiuletyn Polskiej Misji Historycznej = Bulletin der Polnischen Historischen Mission
researchProduct

Measuring phenotypes in fluctuating environments

2020

Despite considerable theoretical interest in how the evolution of phenotypic plasticity should be shaped by environmental variability and stochasticity, how individuals actually respond to these aspects of the environment within their own lifetimes remains unclear. We propose that this understanding has been hampered by experimental approaches that expose organisms to fluctuating environments (typically treatments where fluctuations in the environment are cyclical vs. erratic) for a pre‐determined duration, while ensuring that the mean environment over that the entire exposure period is invariable. This approach implicitly assumes that responses to the mean and variance/predictability in th…

reversible plasticitylämmönsietofungiunpredictable environmentsvesikirputheat tolerancefenotyyppivaihtelulämpötilabet-hedgingthermal toleranceympäristönmuutoksetinsurance
researchProduct

Acclimation capacity and rate change through life in the zooplankton Daphnia

2020

When a change in the environment occurs, organisms can maintain an optimal phenotypic state via plastic, reversible changes to their phenotypes. These adjustments, when occurring within a generation, are described as the process of acclimation. While acclimation has been studied for more than half a century, global environmental change has stimulated renewed interest in quantifying variation in the rate and capacity with which this process occurs, particularly among ectothermic organisms. Yet, despite the likely ecological importance of acclimation capacity and rate, how these traits change throughout life among members of the same species is largely unstudied. Here we investigate these rel…

reversible plasticitysopeutuminenakklimatisaatiolämmönsietoallometryvesikirputheat tolerancefenotyyppibody sizethermal toleranceympäristönmuutokset
researchProduct

Safety and Tolerance Evaluation of Milk Fat Globule Membrane-Enriched Infant Formulas: A Randomized Controlled Multicenter Non-Inferiority Trial in H…

2014

ObjectiveThis multicenter non-inferiority study evaluated the safety of infant formulas enriched with bovine milk fat globule membrane (MFGM) fractions.MethodsHealthy, full-term infants ( n = 119) age ≤14 days were randomized to standard infant formula (control), standard formula enriched with a lipid-rich MFGM fraction (MFGM-L), or standard formula enriched with a protein-rich MFGM fraction (MFGM-P). Primary outcome was mean weight gain per day from enrollment to age 4 months (non-inferiority margin: –3.0 g/day). Secondary (length, head circumference, tolerability, morbidity, adverse events) and exploratory (phospholipids, metabolic markers, immune markers) outcomes were also evaluated.Res…

safetymedicine.medical_specialtyinfant feedingbusiness.industrygrowthGeneral Engineeringlcsh:RJ1-570lcsh:PediatricsGastroenterologyPrimary outcomeTolerabilityStandard infant formulaformula toleranceInternal medicineMedicineNon inferiority trialGlobules of fatmedicine.symptombusinessAdverse effectMilk fat globuleWeight gainBiomedical engineeringOriginal Researchmilk fat globule membraneClinical Medicine Insights: Pediatrics
researchProduct

The Time-Varying Effect of Participatory Shift Scheduling on Working Hour Characteristics and Sickness Absence: Evidence from a Quasi-Experiment in H…

2022

Participatory shift scheduling for irregular working hours can influence shift schedules and sickness absence. We investigated the effects of using participatory shift scheduling and shift schedule evaluation tools on working hour characteristics and sickness absence. We utilized a panel data for 2015&minus;2019 with 16,557 hospital employees (6143 in the intervention and 10,345 in the control group). Difference-in-differences regression with ward-level clustered standard errors was used to estimate the average treatment effect on the treated coefficients relative to timing of the intervention with 95% confidence intervals (CI). Using participatory scheduling tool increased long working hou…

self-rosteringworking hourstyöterveystyöhyvinvointiHealth Toxicology and MutagenesisPublic Health Environmental and Occupational Healthsickness absencesairauspoissaolotHospitalsPersonnel Hospitaltyöaikaself-rostering; shift schedule; sickness absence; working hoursosallistaminenvuorotyötyössäkäyntiWork Schedule Tolerancetyöntekijätshift scheduleHumansSick LeavesairauslomaInternational journal of environmental research and public health
researchProduct

Effective Practices in Mitigating Soil Erosion from Fields

2017

Soil erosion by water is a natural process that cannot be avoided. Soil erosion depends on many factors, and a distinction should be made between humanly unchangeable (e.g., rainfall) and modifiable (e.g., length of the field) soil erosion factors. Soil erosion has both on-site and off-site effects. Soil conservation tries to combine modifiable factors so as to maintain erosion in an area of interest to an acceptable level. Strategies to control soil erosion have to be adapted to the desired land use. Knowledge of soil loss tolerance, T, i.e., the maximum admissible erosion from a given field, allows technicians or farmers to establish whether soil conservation practices need to be applied …

soil erosion soil loss tolerance on-site and off-site erosion impacts soil conservation burned areas erosion modeling for soil conservationSoil biodiversityAgroforestrycomplex mixturesSoil managementNo-till farmingEnvironmental protectionSoil functionsSoil retrogression and degradationEnvironmental scienceSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-ForestaliDryland salinitySoil conservationSurface runoff
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct