Search results for "103"

showing 10 items of 15254 documents

Rivalry of diffusion, external field and gravity in micro-convection of magnetic colloids

2019

Magnetic fields and magnetic materials have promising microfluidic applications. For example, magnetic micro-convection can enhance mixing considerably. However, previous studies have not explained increased effective diffusion during this phenomenon. Here we show that enhanced interface smearing comes from a gravity induced convective motion within a thin microfluidic channel, caused by a small density difference between miscible magnetic and non-magnetic fluids. This motion resembles diffusive behavior and can be described with an effective diffusion coefficient. We explain this with a theoretical model, based on a dimensionless gravitational Rayleigh number, and verify it by numerical si…

010302 applied physicsConvectionGravity (chemistry)Materials scienceFluid Dynamics (physics.flu-dyn)Mixing (process engineering)FOS: Physical sciencesPhysics - Fluid Dynamics02 engineering and technologyRayleigh numberMechanicsCondensed Matter - Soft Condensed Matter021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsMagnetic fieldPhysics::Fluid DynamicsGravitation0103 physical sciencesSoft Condensed Matter (cond-mat.soft)Diffusion (business)0210 nano-technologyDimensionless quantityJournal of Magnetism and Magnetic Materials
researchProduct

Conic optical fiber probe for generation and characterization of microbubbles in liquids

2021

Abstract A novel optical fiber probe has been developed to provide mechanical stability to microbubbles generated in fluids, the tip of the fiber is etched with hydrofluoric acid to pierce a truncated horn that fastens the microbubbles to the fiber tip and prevents misalignment or detachment caused by convection currents, vibrations or shocks in the liquid. Microbubbles are photo-thermally generated on the etched fiber and used as Fabry-Perot cavity sensor. Two methods were used to interrogate the probe: the first one, in the wavelength domain, is suitable for calibration in static or quasi static situations; the second one, in the time domain, can be used in dynamic environments. Experimen…

010302 applied physicsConvectionMaterials sciencebusiness.industryMetals and Alloys02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsWavelengthOptics0103 physical sciencesMicrobubblesCalibrationFiberTime domainElectrical and Electronic Engineering0210 nano-technologybusinessInstrumentationQuasistatic processBar (unit)Sensors and Actuators A: Physical
researchProduct

45° sign switching of effective exchange bias due to competing anisotropies in fully epitaxial Co3FeN/MnN bilayers

2017

We report an unusual angular-dependent exchange bias effect in ferromagnet/antiferromagnet bilayers, where both ferromagnet and antiferromagnet are epitaxially grown. Numerical model calculations predict an approximately 45° period for the sign switching of the exchange-bias field, depending on the ratio between magnetocrystalline anisotropy and exchange-coupling constant. The switching of the sign is indicative of a competition between a fourfold magnetocrystalline anisotropy of the ferromagnet and a unidirectional anisotropy field of the exchange coupling. This predicted unusual angular-dependent exchange bias and its magnetization switching process are confirmed by measurements on fully …

010302 applied physicsCoupling constantMaterials scienceKerr effectCondensed matter physicsCondensed Matter PhysicsMagnetocrystalline anisotropy01 natural sciencesCondensed Matter::Materials ScienceCrystallographyMagnetizationExchange biasFerromagnetism0103 physical sciencesAntiferromagnetismGeneral Materials Science010306 general physicsAnisotropyJournal of Physics: Condensed Matter
researchProduct

Determining the deformation and resulting coupling efficiency degradation of ultrastable fiber-coupled optical benches under load.

2020

Fiber-coupled optical benches are an integral part of many laser systems. The base of such an optical bench is usually a slab of solid material, onto which optical components are fixed. In many environments, the ability to retain high fiber coupling efficiency under mechanical loads is essential. In this article, we study the fiber-to-fiber coupling efficiency under the application of static mechanical loads experimentally and theoretically: We constructed a simple three-point bending setup to interferometrically measure the deformation of an optical bench under load. Using the same setup, we further recorded the resulting coupling efficiency variations. The examined optical benches are bas…

010302 applied physicsCouplingMaterials scienceAcousticsPhysics::OpticsZerodurBendingDeformation (meteorology)Laser01 natural sciencesFinite element method010305 fluids & plasmaslaw.inventionlaw0103 physical sciencesSlabInstrumentationBeam (structure)The Review of scientific instruments
researchProduct

Determination of fine magnetic structure of magnetic multilayer with quasi antiferromagnetic layer by using polarized neutron reflectivity analysis

2020

We carried out polarized neutron reflectivity (PNR) analysis to determine the fine magnetic structure of magnetic multilayers with quasi-antiferromagnetic (quasi-AFM) layers realized by 90-deg coupling using two Co90Fe10 layers, and quantitatively evaluated the magnetization of quasi-AFM layers. Two types of samples with different buffer layers, Ru buffer and a NiFeCr buffer, were investigated and the average angles between the respective magnetization of the two Co90Fe10 layers were estimated to be +/− 39 degrees and +/− 53 degrees. In addition, less roughness was found in the NiFeCr buffer sample resulting stronger 90-deg coupling. A perfect quasi-AFM is expected to be realized by a flat …

010302 applied physicsCouplingMaterials scienceCondensed matter physicsMagnetic structure530 PhysicsGeneral Physics and Astronomy02 engineering and technologySurface finish021001 nanoscience & nanotechnology530 Physik01 natural scienceslcsh:QC1-999Buffer (optical fiber)Magnetization0103 physical sciencesAntiferromagnetismNeutron0210 nano-technologyLayer (electronics)lcsh:Physics
researchProduct

Flexible and efficient computer-aided design tool for advanced comb-line rectangular waveguide filters

2015

A very flexible and efficient computer-aided design CAD tool, specifically suited for advanced comb-line rectangular waveguide filters, is presented in this work. The developed software tool, which makes use of a full-wave analysis technique based on the Boundary Integral-Resonant Mode Expansion method, allows loading the considered comb-line resonators with any number of radially symmetrical partial-height metallic posts. The implemented CAD tool also allows dealing with coupling windows of arbitrary cross-section, thus drastically enhancing the flexibility of the CAD process. The excitation of the analyzed components, which is performed using generalized coaxial probes, has also been inte…

010302 applied physicsCouplingWaveguide filterEngineeringbusiness.industryProcess (computing)020206 networking & telecommunicationsCAD02 engineering and technologycomputer.software_genre01 natural sciencesComputer Graphics and Computer-Aided DesignComputer Science ApplicationsResonatorComponent (UML)0103 physical sciences0202 electrical engineering electronic engineering information engineeringElectronic engineeringComputer Aided DesignElectrical and Electronic EngineeringCoaxialbusinesscomputerInternational Journal of RF and Microwave Computer-Aided Engineering
researchProduct

Mechanochemical Synthesis, Photophysical Properties, and X-ray Structures of N-Heteroacenes (Eur. J. Org. Chem. 7/2016)

2016

010302 applied physicsCrystallography010405 organic chemistryChemistryMechanochemistry0103 physical sciencesOrganic ChemistryX-rayOrganic chemistryPhysical and Theoretical Chemistry01 natural sciences0104 chemical sciencesEuropean Journal of Organic Chemistry
researchProduct

A New Approach to Partial Discharge Detection Under DC Voltage: Application to Different Materials

2021

Usability of a new Direct Current Periodic waveform for partial discharge qualification in HVDC systems is exemplified by tests performed on different materials.

010302 applied physicsDC measurementsHVDCtesting methodbusiness.industryComputer sciencepattern recognitionDirect currentUsability01 natural sciencesElectronic Optical and Magnetic Materialspartial dischargeDc voltagedischarge phenomena0103 physical sciencesPattern recognition (psychology)Partial dischargeElectronic engineeringWaveformElectrical and Electronic EngineeringbusinessIEEE Electrical Insulation Magazine
researchProduct

Partial discharges behavior under different rectified waveforms

2017

In this work, a previous software used to simulate partial discharges (PDs) under Alternating Current (AC) stress has been modified in order to evaluate the PDs behavior under a voltage stress close to the Direct Current (DC) waveform. By using a full-wave and a half-wave rectifier, the specimen with an air void defects has been subjected to a gradual constant stress. Finally, a capacitive filter has been inserted in order to produce a steadier voltage supply. Simulation results show that under an almost DC waveform, the PDs activity become less compared to AC stress.

010302 applied physicsDC stressMaterials scienceHVDCPD modelbusiness.industryAcousticsCapacitive sensingDirect currentElectrical engineeringRectified waveform01 natural sciencesSpace charge010305 fluids & plasmaslaw.inventionStress (mechanics)RectifierSettore ING-IND/31 - Elettrotecnicalaw0103 physical sciencesWaveformPartial DischargebusinessAlternating currentVoltage
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct