Search results for "14"

showing 10 items of 9841 documents

AMATEUR DOPING: A SURVEY AMONG SICILIAN PEOPLE

2018

In last years, Amateur Doping has caused many victims. In order to know the diffusion of this phenomenon, we have conducted an online-survey through Google forms. We also transformed the same questionnaire on paper and it was administered in many gyms in Palermo and Trapani (Sicily-Italy). The sample examined consists of 976 people aged between 14 and 65 (47.3% of them are women and 52.7% are men). We asked them if they ever took on substances to improve their athletic performances: 25.8% of them answered affirmatively and they declared to take on protein, amino acids but also Eca Stacks, which are hired on regular basis (34.6%). They bought this substances in sporting stores (32.2%), in ph…

doping substancesDopingSettore BIO/14 - Farmacologia
researchProduct

Il progetto di restauro del moderno: consuntivo di una esperienza

2013

Il volume, che segue altre due pubblicazioni, riguarda il lavoro del Dottorato in Progettazione Architettonica di Palermo sul restauro del moderno. Il saggio dell'autore, coordinatore del Dottorato, traccia una valutazione complessiva dell'esperienza, con una attenzione particolare al tema della scientificità del progetto all'interno del Dottorato. Sono anche presentati alcuni progetti di restauro del moderno elaborati nel Dottorato.

dottoratoSettore ICAR/14 - Composizione Architettonica E Urbanascientificità del progettorestauro del moderno
researchProduct

Dottorato di ricerca e ruolo del progetto

2011

Il testo analizza il ruolo del progetto all'interno di un Dottorato di ricerca in Progettazione Architettonica, quello di Palermo, e ne illustra i requisiti teorici e di scientificità in relazione alla specificità del Dottorato.

dottoratoscientificità.Settore ICAR/14 - Composizione Architettonica E Urbanaprogetto
researchProduct

Value of the Axial-Vector Coupling Strength in β and ββ Decays : A Review

2017

double beta decaysaxial-vector coupling strengthta114beta spectramuon captureforbidden beta decayscharge-exchange reactionsGamow-Teller beta decaysstrength functionsFrontiers in Physics
researchProduct

Studying the double-frequency heating mode in ECRIS plasma using Kα diagnostics

2018

Despite the success of double-heating frequency in enhancing high charge state production, the underlying physics remains poorly understood. By combining three different diagnostic techniques i.e. Kα emission, optical emission and the extracted charge state distribution, it is now possible to assess the proposed explanations for the effectiveness of double-frequency heating against the experimental results. These results seem to indicate that the increase of plasma density accounts largely for the favorable behavior of this operation mode compared to single-frequency mode. peerReviewed

double-heating frequencyMaterials scienceta114syklotronitemissionMode (statistics)PlasmaAtomic physicsDouble frequencyplasmafysiikkaplasmaplasma (kaasut)emissio (fysiikka)
researchProduct

Architettura: vestito estremo

2012

Il testo tratta dell'architettura come vestito. La natura tessile dell'architettura viene indagata a partire dalle terorizzazioni di Semper e di Wright. Si considera anche il rapporto tra corpo ed extracorpo e conseguentemente dell'architettura come protesi The essay deals with the notion of architecture as dressing. The textile nature of architecture is discussed (Semper, Wright). It also deals with the relationship between body and extrabody. Consistently the prosthetic status of architecture is focused.

dressing bodySettore ICAR/14 - Composizione Architettonica E Urbanavestito tessile
researchProduct

A Forensic Diagnostic Algorithm for Drug-Related Deaths: A Case Series

2022

The best evidence provided in the literature worldwide suggests the importance of harmonizing the investigation in drug-related fatalities. In this study, the application of a multidisciplinary approach in eight cases of drug-related deaths is presented. Although death scene findings could be highly suggestive of drug intoxication, external examination and toxicological screening test alone are insufficient. There are several variables, and it is not always easy to give the proper interpretation of the drug detection. A complete autopsy is necessary to correctly complete organ and tissues sampling for further histological and toxicological studies and obtain body fluids. The use of peripher…

drug intoxication diagnosisdrug-related deaths; forensic diagnosis; diagnostic algorithm; drug intoxication diagnosisChemical Health and SafetySettore MED/43 - Medicina LegaleHealth Toxicology and Mutagenesisdrug-related deathSettore BIO/14 - FarmacologiaSettore MED/05 - Patologia Clinicaforensic diagnosiToxicologydiagnostic algorithmToxics
researchProduct

Dualità e transiti nella didattica del progetto

2008

dualitàdidatticaarchitetturaSettore ICAR/14 - Composizione Architettonica E Urbana
researchProduct

Patient flows through Valhalla : A survival analysis in the context of short-term care institutions

2019

Master's thesis Business Administration BE501 - University of Agder 2019 Individuals experiencing functional decline may often require some form of assistance in order to reassume their activities of daily living. A common form of rehabilitation is a stay at a short-term institution, yet readmissions to such care facilities often occur. Home-based reablement has surfaced in Norway during the past ten years and aims to assist the user in reaching their own activity goals through a self-committed and intensive program, assisted by health care workers. The objective of this study isinquiring into the patient flows between home-nurse areas and short-term institutions in southern Norway over the…

duration modelingVDP::Medisinske Fag: 700::Helsefag: 800reablementBE501JEL classification: I18 J14 C41survival analysis
researchProduct

Cardiotossicità da chemioterapici: considerazioni farmacologiche e ruolo dell’ecocardiografia nella sua valutazione clinica

2012

ecocardiografiaChemioterapiaSettore BIO/14 - Farmacologia
researchProduct