Search results for "1506"

showing 10 items of 235 documents

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Respiratory chain polymorphisms and obesity in the Spanish population, a cross-sectional study

2019

ObjectiveTo study the association of genes involved in the mitochondrial respiratory chain (MRC) pathway with body mass index (BMI) and obesity risk.DesignThis work studies three cross-sectional populations from Spain, representing three provinces: HORTEGA (Valladolid, Northwest/Centre), SEGOVIA (Segovia, Northwest/centre) and PIZARRA (Malaga,South).SettingForty-eight single nucleotide polymorphisms (SNPs) from MRC genes were selected and genotyped by SNPlex method. Association studies with BMI and obesity risk were performed for each population. These associations were then verified by analysis of the studied population as a whole (3731 samples).ParticipantsA total of 3731 Caucasian indivi…

AdultMaleobesityGenotypeCross-sectional studyPopulationRespiratory chainmitochondrial respiratory chain030209 endocrinology & metabolismSingle-nucleotide polymorphismPolymorphism Single NucleotideWhite PeopleBody Mass IndexMitochondrial Proteins03 medical and health sciences0302 clinical medicineRisk FactorsMedicineHumans1506educationAlleles030304 developmental biologyGenetic associationAged0303 health scienceseducation.field_of_studybusiness.industryResearch1697Genetics and GenomicssnpGeneral MedicineMiddle Agedmedicine.diseaseObesityMitochondrial respiratory chainCross-Sectional StudiesElectron Transport Chain Complex ProteinsSpainFemalebusinessBody mass indexDemographyBMJ Open
researchProduct

Cervical ectopy: associations with sexually transmitted infections and HIV. A cross-sectional study of high school students in rural South Africa.

2014

Objectives It has been hypothesised that ectopy may be associated with increased susceptibility to sexually transmitted infections (STIs). In this cross-sectional study, we wanted to explore the association between STIs (including HIV) and cervical ectopy. Methods We included 700 sexually active young women attending randomly selected high schools in a rural district in KwaZulu-Natal, South Africa. The district is endemic of HIV and has a high prevalence of STIs. We did computer-assisted measurements of the ectocervical area covered by columnar epithelium (ectopy) in colposcopic images and STI analyses on cervicovaginal lavage and serum samples. All participating women answered a questionna…

AdultRural PopulationAFRICAmedicine.medical_specialtyAdolescentCross-sectional studyEpidemiologyPopulationECTOPYChlamydia trachomatisDermatologyCervix UteriChoristomamedicine.disease_causeurologic and male genital diseasesSouth AfricaYoung AdultAcquired immunodeficiency syndrome (AIDS)Surveys and QuestionnairesmedicineHumans1506Young adulteducationStudentsCervixGynecologyeducation.field_of_studyChlamydiaSchoolsObstetricsbusiness.industryHIVChlamydia Infectionsmedicine.diseasefemale genital diseases and pregnancy complicationsCHLAMYDIA INFECTIONInfectious Diseasesmedicine.anatomical_structureCross-Sectional StudiesMenarcheFemaleDisease SusceptibilityChlamydia trachomatisbusinessSexually transmitted infections
researchProduct

Internet-delivered Cognitive-Behavioral Therapy (iCBT) for Adults with Prolonged Grief Disorder (PGD): A Study Protocol for a Randomized Feasibility …

2021

IntroductionGrief is an emotional reaction to the loss of a loved one with a natural recovery. Approximately 10% of people who lose a loved one develop prolonged grief disorder (PGD). Internet-based and computer-based interventions (ie, internet-delivered cognitive–behavioural therapy, iCBT) are a cost-effective alternative that makes it possible to reach more people with PGD. The main aim of this study is to assess the feasibility of a new iCBT—called GROw—for PGD. As a secondary objective, the potential effectiveness of GROw will be explored.Methods and analysisThis study is a two-arm feasibility randomised trial. A total of 48 adults with PGD who meet the eligibility criteria will be ran…

Adultmedicine.medical_specialtyMindfulnessprotocols & guidelinesmedia_common.quotation_subjectmedicine.medical_treatmentPsychological interventionProlonged grief disorder03 medical and health sciences0302 clinical medicineQuality of life (healthcare)medicinetherapeuticsHumans1506030212 general & internal medicinePsychiatryRandomized Controlled Trials as Topicmedia_commonInternetCognitive Behavioral Therapybusiness.industryConducta (Psicologia)RGeneral MedicineMental health030227 psychiatryCognitive behavioral therapyTreatment OutcomeMental HealthSpainQuality of LifeFeasibility StudiesAnxietyMedicine1712GriefGriefMortmedicine.symptombusinessmental healthBMJ Open
researchProduct

Impact of bacterial probiotics on obesity, diabetes and non-alcoholic fatty liver disease related variables: a systematic review and meta-analysis of…

2019

ObjectiveTo systematically review the effect of oral intake of bacterial probiotics on 15 variables related to obesity, diabetes and non-alcoholic fatty liver disease.DesignSystematic review and meta-analysis.Data sourcesMedline, EMBASE and COCHRANE from 1990 to June 2018.Eligibility criteriaRandomised controlled trials (≥14 days) excluding hypercholesterolaemia, alcoholic liver disease, polycystic ovary syndrome and children <3 years.ResultsOne hundred and five articles met inclusion criteria, representing 6826 subjects. In overweight but not obese subjects, probiotics induced improvements in: body weight (k=25 trials, d=−0.94 kg mean difference, 95% CI −1.17 to −0.70, I²=0.0%), body ma…

Alcoholic liver diseasemedicine.medical_specialtyobesitybifidobacteriumGastroenterology03 medical and health sciences0302 clinical medicineInsulin resistanceDiabetes mellitusInternal medicinemedicineDiabetes MellitusHumans030212 general & internal medicine1506BifidobacteriumRandomized Controlled Trials as Topic2. Zero hunger[SDV.MHEP.EM] Life Sciences [q-bio]/Human health and pathology/Endocrinology and metabolismNutrition and Metabolismbiologydiabetesbusiness.industryProbioticsResearchFatty livernon-alcoholic fatty liver diseaseGeneral Medicine[SDV.MHEP.EM]Life Sciences [q-bio]/Human health and pathology/Endocrinology and metabolismmedicine.diseasebiology.organism_classificationPolycystic ovaryObesity3. Good healthlactobacillus[SDV.AEN] Life Sciences [q-bio]/Food and NutritionTreatment Outcome[SDV.SPEE] Life Sciences [q-bio]/Santé publique et épidémiologieDietary Supplements[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologie1714businessBody mass index[SDV.AEN]Life Sciences [q-bio]/Food and Nutrition030217 neurology & neurosurgeryBMJ open
researchProduct

Aversive tension of adolescents with anorexia nervosa in daily course: a case-controlled and smartphone-based ambulatory monitoring trial.

2014

Introduction Monitoring and reduction of aversive tension is a core issue in dialectical behaviour therapy of patients. It has been shown that aversive tension is increased in adult borderline personality disorder and is linked to low emotion labelling ability. However, until now there is no documented evidence that patients with anorexia nervosa suffer from aversive tension as well. Furthermore the usability of a smartphone application for ambulatory monitoring purposes has not been sufficiently explored. Methods and analysis We compare the mean and maximum self-reported aversive tension in 20 female adolescents (12–19 years) with anorexia nervosa in outpatient treatment with 20 healthy co…

Anorexia NervosaAdolescentMental HealthBehavior TherapyCase-Control StudiesAmbulatory CareProtocolHumansFemale1712Smartphone1506ChildStress Psychological1719BMJ open
researchProduct

Protocol for developing a mental imagery intervention: a randomised controlled trial testing a novel implementation imagery e-health intervention to …

2019

IntroductionDrowning due to driving into floodwater accounts for a significant proportion of all deaths by drowning. Despite awareness campaigns such as ‘If it’s flooded, forget it’, people continue to drive into floodwater. This causes loss of life, risk to rescuers and damage to vehicles. The aim of this study was to develop and evaluate an online e-health intervention to promote safe driving behaviour during flood events.Methods and analysisThe study will use a 2×3 randomised controlled trial in which participants are randomised into one of two conditions: (1) education about the risks of driving into floodwater or (2) education about the risks of driving into floodwater plus a theory-ba…

Automobile DrivingImagery Psychotherapysocial-cognitive theoriesflooded waterwaysIntentionHealth interventionlaw.invention03 medical and health sciences0302 clinical medicineRisk-TakingRandomized controlled triallawInformed consentIntervention (counseling)drivingProtocolMedicineHumans1724030212 general & internal medicine1506Randomized Controlled Trials as TopicProtocol (science)water safetymental imagerybusiness.industrydrowning1359General Medicinemedicine.diseaseFloodsTelemedicineMedical emergencyHuman researchPublic Healthbusiness030217 neurology & neurosurgerySocial cognitive theoryMental imageBMJ open
researchProduct

Flash glucose monitoring reduces glycemic variability and hypoglycemia: real-world data from Spain.

2020

ObjectiveObservations in real-world settings support and extend findings demonstrated in randomized controlled trials that show flash glucose monitoring improves glycemic control. In this study, Spain-specific relationships between testing frequency and glycemic parameters were investigated under real-world settings.Research design and methodsDeidentified glucose and user scanning data were analyzed and readers were rank ordered into 20 equal sized groups by daily scan frequency. Glucose parameters were calculated for each group: estimated HbA1c, time below range (<70 and ≤54 mg/dL), within range (70–180 mg/dL), and above range (>180 mg/dL). Glycemic variability (GV) metrics were desc…

Blood Glucosemedicine.medical_specialtyEndocrinology Diabetes and Metabolism030209 endocrinology & metabolismHypoglycemialaw.invention03 medical and health sciences0302 clinical medicineRandomized controlled triallawInternal medicineDiabetes mellitusmedicineHumans030212 general & internal medicine1506GlycemicBlood glucose monitoringmedicine.diagnostic_testbusiness.industryBlood Glucose Self-MonitoringEmerging Technologies Pharmacology and Therapeuticsmedicine.diseaseDiabetes Mellitus Type 1GlucosehypoglycemiaSpainCardiologyglycemic controlblood glucose monitoringbusinessReal world dataBMJ open diabetes researchcare
researchProduct

Interleukin-30 feeds breast cancer stem cells via CXCL10 and IL23 autocrine loops and shapes immune contexture and host outcome

2021

BackgroundBreast cancer (BC) progression to metastatic disease is the leading cause of death in women worldwide. Metastasis is driven by cancer stem cells (CSCs) and signals from their microenvironment. Interleukin (IL) 30 promotes BC progression, and its expression correlates with disease recurrence and mortality. Whether it acts by regulating BCSCs is unknown and could have significant therapeutic implications.MethodsHuman (h) and murine (m) BCSCs were tested for their production of and response to IL30 by using flow cytometry, confocal microscopy, proliferation and sphere-formation assays, and PCR array. Immunocompetent mice were used to investigate the role of BCSC-derived IL30 on tumor…

Cancer Research2434ImmunologyTriple Negative Breast NeoplasmsBiologyInterleukin-23Paracrine signallingMiceCancer stem cellCell Line Tumorbreast neoplasmsImmunology and Allergytumor microenvironmentAnimalsHumans1506Autocrine signallingRC254-282PharmacologyTumor microenvironmentbreast neoplasms cytokines tumor microenvironmentInterleukinsInnate lymphoid cellNeoplasms. Tumors. Oncology. Including cancer and carcinogensFOXP3Basic Tumor ImmunologyDendritic cellcytokinesChemokine CXCL10Autocrine CommunicationOncologyKLF4Cancer researchNeoplastic Stem CellsMolecular MedicineFemaleJournal for Immunotherapy of Cancer
researchProduct

In the literature: February 2019

2019

Malignant pleural mesothelioma (MPM) is a rare and lethal cancer associated to asbestos exposure. Currently, the pemetrexed and cisplatin combination chemotherapy remains the only approved treatment. In the last 5 years, a growing knowledge on mesothelioma pathobiology has translated into the development of multiple novel therapeutic strategies.1 One of the largest reports of comprehensive genomic profiling of MPM was conducted by Bueno and colleagues. Using RNA-seq data, they identified four distinct molecular subtypes, and through exome analysis, they found that BAP1 , NF2 , TP53 , SETD2 , DDX3X , ULK2 , RYR2 , CFAP45 , SETDB1 and DDX51 were significantly mutated.2 In an article recently …

Cancer ResearchBAP1business.industryCombination chemotherapyNewslcsh:Neoplasms. Tumors. Oncology. Including cancer and carcinogensmedicine.diseaselcsh:RC254-282PemetrexedMRNA SequencingOncologySETD2DNA methylationCancer researchmedicine1506MesotheliomabusinessExomemedicine.drugESMO Open
researchProduct