Search results for "1713"

showing 10 items of 38 documents

[Resolució, 1713]

Com a tít. el començament del text Sense signatura. Plantilla de document destinada a enviar a diferents llocs per D. Francisco De Salcedo y Aguirre, Marqués del Vadillo Cristus a la part superior del full

Impostos Andalusia 1713 Obres anteriors al 1800
researchProduct

Enhorabuena

Precedeix al tít.: ✠ Fris, filets Text a 1 col. - Reclams Sign.: [ ]2

Ferran VI rei d'Espanya 1713-1759 Poesia Obres anteriors al 1800Poesia castellana S. XVIII Fonts Obres anteriors al 1800
researchProduct

Noticia de las funciones, y regocijos, que se han executado en la Villa, y Corte de Madrid à la feliz entrada que ha hecho el dia 10. de octubre nues…

Títol pres d'inici de text Peu d'impremta pres del colofó Precedeix al títol: [Creu de Malta L'any 1746 és el de l'esdeveniment, segons consta a l'índex ms Caplletra ornada al començament del text i vinyeta al final

Festivals Madrid (Comunitat Autònoma) 1746 Obres anteriors al 1800.Ferran VI rei d'Espanya 1713-1759 Obres anteriors al 1800.
researchProduct

Demonstracion obsequiosa que en festiva celebridad del feliz alegre dia del nombre de su Magestad ...

Fris, caplletres ornades, filets Text a 1 col. - Reclams Sign.: [ ]2, A-D4

Ferran VI rei d'Espanya 1713-1759 Obres anteriors al 1800Festivals València s. XVIII Obres anteriors al 1900
researchProduct

Relacion verdadera de las fiestas que la muy noble y ilustre quanto leal ciudad de Valencia hizo à la Real Proclamacion de nuestro catolico y soberan…

Precedeix al títol: [Creu de Malta Dades del peu d'impremta preses del colofó Data deduïda del text Text a 2 col. - Reclams Signatures: A14 Esc. xil. reial d'Espanya entre el tít. i el text

Ferran VI rei d'Espanya 1713-1759 Obres anteriors al 1800. lemacFestivals Comunitat Valenciana 1746 Obres anteriors al 1800. lemac
researchProduct

Search for Cosmic Neutrino Point Sources with Four Year Data of the ANTARES Telescope

2012

In this paper, a time-integrated search for point sources of cosmic neutrinos is presented using the data collected from 2007 to 2010 by the ANTARES neutrino telescope. No statistically significant signal has been found and upper limits on the neutrino flux have been obtained. Assuming an E ¿2 n; spectrum, these flux limits are at 1-10 ¿10¿8 GeV cm¿2 s¿1 for declinations ranging from ¿90° to 40°. Limits for specific models of RX J1713.7¿3946 and Vela X, which include information on the source morphology and spectrum, are also given.

cosmic neutrinosUNIVERSEFluxVela01 natural scienceslaw.inventionHigh Energy Physics - ExperimentHigh Energy Physics - Experiment (hep-ex)lawSIGNALSABSORPTION[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]MAXIMUM-LIKELIHOOD010303 astronomy & astrophysicsATMOSPHERIC MUONSPhysicsHigh Energy Astrophysical Phenomena (astro-ph.HE)COSMIC cancer database[SDU.ASTR.HE]Sciences of the Universe [physics]/Astrophysics [astro-ph]/High Energy Astrophysical Phenomena [astro-ph.HE]ASTRONOMYneutrinosastroparticle physicsFísica nuclearNeutrinoAstrophysics - High Energy Astrophysical PhenomenaREMNANT RX J1713.7-3946Particle physics[PHYS.ASTR.HE]Physics [physics]/Astrophysics [astro-ph]/High Energy Astrophysical Phenomena [astro-ph.HE]Astrophysics::High Energy Astrophysical PhenomenaNeutrino telescope[SDU.STU]Sciences of the Universe [physics]/Earth SciencesFOS: Physical sciencesddc:500.2Telescopeneutrinos; cosmic rays; astroparticle physicscosmic rays0103 physical sciencesPoint (geometry)ALGORITHMNeutrinosDETECTORCosmic raysUNDERWATER CHERENKOV NEUTRINO TELESCOPES010308 nuclear & particles physicsAstronomy and AstrophysicsHIGH-ENERGY PHOTONSSpace and Planetary ScienceFISICA APLICADAAstroparticle physics
researchProduct

Proclamacion tierna y festiva de la fidelissima y siempre augusta imperial ciudad de Zaragoza : en la gloriosa exaltacion de su adorado ... monarca D…

Filets Sign.: A-C4 Text a 1 col. - Postil·les. - Reclams

Poesia castellana S. XVIII Fonts Obres anteriors al 1800Ferran VI rei d'Espanya 1713-1759 Obres anteriors al 1800
researchProduct

Breve expression, y aviso de la aclamacion, y levantamiento de Pendones, hecha en la ... Ciudad de Zaragoza ... en el dia 29 de Septiembre de 1746 po…

Port. amb orla tip. i escut xil Fris, caplletra ornada Sign.: A-E4 Reclams

Festivals Aragó Saragossa 1746 Obres anteriors al 1800Ferran VI rei d'Espanya 1713-1759 Obres anteriors al 1800
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

El Rey de España en Bayona : Escena en un solo acto

L'autor és Juan José Aparicio Ornament tip. a la port Sign.: [A]4, B-D4 Text a dues col

Teatre castellà 1808-1814Ferran VI rei d'Espanya 1713-1759 Teatre
researchProduct