Search results for "ABO"

showing 10 items of 13628 documents

A single transient episode of hyperammonemia induces long-lasting alterations in protein kinase A.

2007

A single transient episode of hyperammonemia induces long-lasting alterations in protein kinase A. Am J Physiol Gastrointest Liver Physiol 292: G305-G314,2007; doi:10.1152/ajpgi.00100.2006.-Hepatic encephalopathy in patients with liver disease is associated with poor prognosis. This could be due to the induction by the transient episode of hepatic encephalopathy of long-lasting alterations making patients more susceptible. We show that a single transient episode of hyperammonemia induces long-lasting alterations in signal transduction. The content of the regulatory subunit of the protein kinase dependent on cAMP (PKA-RI) is increased in erythrocytes from cirrhotic patients. This increase is…

soluble guanylate cyclaseAdultLiver CirrhosisMalemedicine.medical_specialtyCirrhosisErythrocytesPhysiologyliver cirrhosisEncephalopathyhepatic encephalopathyBiologyHepatitisLiver diseaseLiver Function TestsReference ValuesPhysiology (medical)Internal medicinemedicineAnimalsHumansHyperammonemiaRats WistarProtein kinase AHepatic encephalopathyAgedHepatologyPortacaval anastomosisMetabolic disorderErythrocyte MembraneGastroenterologyAscitesHyperammonemiaMiddle Agedmedicine.diseaseCyclic AMP-Dependent Protein KinasesRatsDisease Models AnimalEndocrinologyChronic Diseaserat modelsFemaleLiver FailureAmerican journal of physiology. Gastrointestinal and liver physiology
researchProduct

Didáctica de las ciencias experimentales y sociales

1993

Resumen tomado del autor. Resumen también en inglés Los problemas experimentales reúnen las virtudes de los problemas de lápiz y papel y de las prácticas de laboratorio en Física; ellos pueden ser utilizados para introducir conocimientos teóricos sobre una base experimental y también para aplicar en la práctica dichos conocimientos. El propósito de este artículo es analizar la importancia de tales problemas y mostrar algunos ejemplos de ellos. Valencia Universidad de León. Facultad de Educación. Servicio de Biblioteca; Campus de Vegazana, s. n.; 24071 León; Tel. +34987291146; Fax +34987291145; bufed@unileon.es ; bufed1@unileon.es ESP

solución de problemasfísicaexperiencia de laboratoriodidáctica
researchProduct

Impact of the Extraction Method on the Chemical Composition and Antioxidant Potency of Rosmarinus officinalis L. Extracts

2023

Rosmarinus officinalis L. is a dietary source that produces polyphenols as secondary metabolites. These natural compounds with potent antioxidant abilities are increasingly recommended as a supplement to inhibit oxidative stress. In the current work, we evaluated the impact of the extraction method on the chemical composition of R. officinalis extract, especially on the content of carnosic (CA) and rosmarinic (RA) acids using UPLC-MS-DAD as well as on their antioxidant potency. Four extracts of Tunisian rosemary were obtained from non-conventional extraction techniques:ultrasound-assisted extraction (UAE),supercritical extraction (SFE) and UAE and SFE combined ((UAE-SFE(I), UAE-SFE(II)). Th…

sonication<i>Rosmarinus officinalis</i> L.antioxidantUPLC-MS-DAD analysisEndocrinology Diabetes and MetabolismRosmarinus officinalis L UPLC-MS-DAD analysis antioxidant sonication supercritical extractionsupercritical extractionMolecular BiologyBiochemistry
researchProduct

Population divergence in maternal investment and embryo energy use and allocation suggests adaptive responses to cool climates

2023

1. The thermal sensitivity of early life stages can play a fundamental role in constraining species distributions. For egg-laying ectotherms, cool temperatures often extend development time and exacerbate developmental energy cost. Despite these costs, egg laying is still observed at high latitudes and altitudes. How embryos overcome the developmental constraints posed by cool climates is crucial knowledge for explaining the persistence of oviparous species in such environments and for understanding thermal adaptation more broadly. 2. Here, we studied maternal investment and embryo energy use and allocation in wall lizards spanning altitudinal regions, as potential mechanisms that enable su…

sopeutuminenmetabolic rateliskotincubation temperaturelevinneisyysembryo retentionthyroid hormonedevelopmental rateilmastomaternal effectslämpötilacost of developmentlajitoffspring size
researchProduct

The oxidative capacity of skeletal muscle : effects of genotype, high-fat diet and physical activity

2016

sopeutuminenmitochondrial biogenesisrasvatexerciselihaksetliikuntafysiologiaadaptationhiiretruokavaliotgenotyyppiangiogenesishigh-fat dietgene expressionmetabolinen oireyhtymäfyysinen aktiivisuushapenotto
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Range expansion to novel environments : evolutionary physiology and genetics in Leptinotarsa decemlineata

2010

sopeutuminentulokaslajitkoloradonkuoriainenlevinneisyysadaptationdiapaussigeneettinen muunteluinvasive speciesdiapauseenergia-aineenvaihduntacolorado beetleinsectiside stressenergy metabolismgenetic variationvieraslajit
researchProduct

Human dignity in the learning environment : testing a sociological paradigm for a diversity-positive milieu with school starters

2004

sosiaalinen kasvatusoppimisympäristökoulutulokkaatalkuopetusconsultation skillshuman rights educationkouluympäristökouluyhteisöconflict preventionyhteistyöschool environmentsociometric metersluokkayhteisökoulukiusaaminenconflict resolutionholistic thinkingsystems theoryryhmätparent and teacher collaborationkotipeace and justice educationsyrjäytyminenilmapiiriihmisarvooikeudenmukaisuuserilaisuusschool startersvanhemmatworld citizenship educationdiversity-positive environmentaction researchsuvaitsevaisuusyhteisvastuukouluglobal education
researchProduct

Second-generation immigrants and factors that create challenges to enter Finnish labour market

2018

The aims of this study are to find out the most key factors that have negatively influenced second-generation immigrants with different foreign origins and ethnicities in their quest for job opportunities in the Finnish labour market. This stud‎y was done through qualitative research methods, which consisted of 15 second-generation immigrants, aged 18-35. These immigrants were divided into three main groups, which included European, Asian, and those of African backgrounds. This was to examine the role of ethnic aspects and to analyse the level of discrimination on different bases. The study was done through depth semi-structured face-to-face interviews. The questions which I asked the parti…

sosiaaliset verkostotsyrjintäsocial networktyömarkkinatsecond-generation immigrantsmaahanmuuttajatmaahanmuuttajataustalabour marketdiscrimination
researchProduct

Yhteisöllinen argumentointi sosionomikoulutuksessa avoimia ongelmia ratkottaessa

2017

The aim of this study was to develop teaching methods for practising argumentative problem-solving in a degree program of social services. The purpose was to acquire knowledge about multiple (face-to-face, online, and integrated) learning environments for studying argumentative problem-solving. In addition, the typical features of collaborative argumentation in student discussions were identified. Two teaching experiments were arranged in courses on drug and alcohol abuse. Both experiments required students to solve open-ended problems through role-play regarding a fictive girl’s use of alcohol. The idea of blended learning was applied in the first teaching experiment. Students (n = 29) wro…

sosionomitblended learningkorkeakouluopetuscollaborative argumentationhigher educationkorkea-asteen koulutusComputingMilieux_COMPUTERSANDEDUCATIONopen-ended problemsopetusmenetelmätargumentointirole-playammattitaitoongelmanratkaisuyhteisöllinen oppiminenargumentative problem-solvingmonimuoto-opetus
researchProduct