Search results for "ADVERSE EVENTS"

showing 10 items of 85 documents

Childhood Victimization by Adults and Peers and Health-Risk Behaviors in Adulthood

2019

AbstractVictimization experienced in childhood has been linked with health-risk behaviors (HRBs) in adulthood. The purpose of this cross-sectional survey was to provide data regarding the HRBs using the ISPCAN Child Abuse Screening Tool Retrospective version (ICAST-R), Spanish version. This aimed to broaden existing knowledge by assessing both being victimized by adults and by peers in a Spanish general population of 348, aged 18–35. Age and timing of the reported victimization were also considered. Victimization: physical, psychological, sexual abuse by adults and/or peers showed a prevalence of 44.54%. Of these, 41.29% reported abuse by both. Children victimized by adults, regardless of t…

AdultMaleChild abuseLinguistics and LanguageAdolescentSubstance-Related DisorderseducationPopulationPoison controlSuicide AttemptedSuicide preventionPeer GroupLanguage and LinguisticsYoung Adult03 medical and health sciences0302 clinical medicineInjury preventionmedicineHumans0501 psychology and cognitive sciencesChild Abuse030212 general & internal medicineChildeducationCrime Victimshealth care economics and organizationsGeneral Psychologyeducation.field_of_studyAdult Survivors of Child AbuseMental Disorders05 social sciencesBullyingsocial sciencesmedicine.diseaseSubstance abuseCross-Sectional StudiesAdult Survivors of Child Adverse EventsSexual abuseChild PreschoolPeer victimizationFemalePsychology050104 developmental & child psychologyClinical psychologyThe Spanish Journal of Psychology
researchProduct

Second Malignancies Following Childhood Cancer Treatment in Germany From 1980 to 2014.

2018

BACKGROUND Because of improvements in cancer treatment, more than 80% of all children with cancer now survive at least five years from the time of diagnosis. As a result, late sequelae of cancer and its treatment have become more common, particularly second malignancies. We studied the current incidence of second malignancies among childhood cancer survivors in Germany. METHODS This study is based on the cohort of the German Childhood Cancer Registry (Deutsches Kinderkrebsregister, DKKR). Persons given the diagnosis of a first malignancy at any time in the years 1980-2014 who were no more than 14 years old at the time of diagnosis and survived at least six months thereafter were included in…

AdultMalePediatricsmedicine.medical_specialtyPopulationMalignancy03 medical and health sciencesYoung Adult0302 clinical medicineCancer SurvivorsRisk FactorsGermanymedicineHumansCumulative incidence030212 general & internal medicineRegistrieseducationChildProportional Hazards Modelseducation.field_of_studyChildhood Cancer Registrybusiness.industryIncidence (epidemiology)IncidenceHazard ratioCancerNeoplasms Second PrimaryGeneral MedicineMiddle Agedmedicine.diseaseAdult Survivors of Child Adverse Events030220 oncology & carcinogenesisCohortFemaleOriginal ArticlebusinessDeutsches Arzteblatt international
researchProduct

Parenting in the face of serious illness: Childhood cancer survivors remember different rearing behavior than the general population

2019

Objective A child's cancer diagnosis and treatment affect the whole family. While it has been recognized that parents are an important resource for their children, little is known about the specifics of parenting in the face of serious illness. Methods We used the Recalled Parental Rearing Behavior Questionnaire in a register-based cohort of adult childhood cancer survivors (CCS) (N = 951) and a representative population sample of the same age range (N = 2042). The questionnaire assesses behavior of mothers and fathers with three scales (emotional warmth, rejection/punishment, and control/overprotection) by querying the (former) child. We compared the two groups using general linear models.…

AdultMalePunishment (psychology)PopulationVulnerabilityExperimental and Cognitive PsychologyDiseaseAffect (psychology)Developmental psychologyYoung Adult03 medical and health sciencesChild Rearing0302 clinical medicineCancer SurvivorsSurvivorship curveParenting stylesHumans030212 general & internal medicineParent-Child RelationsChildeducationeducation.field_of_studyParentingMiddle AgedPsychiatry and Mental healthAdult Survivors of Child Adverse EventsOncology030220 oncology & carcinogenesisCohortFemalePsychologyPsycho-Oncology
researchProduct

Patients with adenoid cystic carcinomas of the salivary glands treated with lenvatinib: Activity and quality of life

2019

The treatment of patients with recurrent and/or metastatic (R/M) salivary gland adenoid cystic carcinoma (ACC) remains an unmet need.Patients with R/M disease with a history of clinical or symptomatic disease progression within 6 months and a maximum of 1 previous line of chemotherapy or a multiple kinase inhibitor received oral lenvatinib at a dose of 24 mg/day. The primary endpoint was the objective response rate; secondary endpoints included quality of life (QOL) (according to the European Organization for Research and Treatment of Cancer Quality of Life Questionnaire-Core 30 Items [EORTC QLQ-C30] and the European Organization for Research and Treatment of Cancer Quality of Life Question…

AdultMaleadenoid cystic carcinoma; lenvatinib; quality of life; toxicityCancer Researchmedicine.medical_specialtyAdenoid cystic carcinomaAntineoplastic Agentslenvatinib03 medical and health scienceschemistry.chemical_compound0302 clinical medicineSwallowingQuality of lifeInternal medicinemedicineClinical endpointHumansadenoid cystic carcinomaProspective Studies030212 general & internal medicineNeoplasm MetastasisProtein Kinase InhibitorsDose-Response Relationship Drugbusiness.industryPhenylurea CompoundstoxicityCancerCommon Terminology Criteria for Adverse EventsMiddle AgedSalivary Gland Neoplasmsmedicine.diseaseCarcinoma Adenoid CysticSurvival AnalysisSalivary Gland Adenoid Cystic Carcinomaquality of lifeOncologychemistry030220 oncology & carcinogenesisQuinolinesFemaleNeoplasm Recurrence LocalbusinessLenvatinibCancer
researchProduct

Systemic chemotherapy and pressurized intraperitoneal aerosol chemotherapy (PIPAC): A bidirectional approach for gastric cancer peritoneal metastasis

2019

Abstract Background Few patients affected by gastric cancer peritoneal metastasis (GCPM) are offered locoregional treatment, despite several proof-of-efficacy trials. Pressurized intraperitoneal aerosol chemotherapy (PIPAC) has emerged in recent years as a promising tool to control peritoneal carcinomatosis. The combination of PIPAC with systemic chemotherapy may offer a greater clinical benefit than standard treatment alone. Methods A single-center cohort of 28 consecutive patients affected by GCPM was scheduled for bidirectional treatment, comprising PIPAC and systemic chemotherapy, from September 2017 to September 2019. Data recorded included safety, efficacy and survival outcomes. Ascit…

AdultMalemedicine.medical_specialtyIntraoperative Complicationmedicine.medical_treatmentPopulation03 medical and health sciences0302 clinical medicineStomach NeoplasmsAntineoplastic Combined Chemotherapy ProtocolsmedicinePressureHumansProspective StudieseducationPeritoneal NeoplasmsAgedRetrospective StudiesAerosolseducation.field_of_studyChemotherapyPressurized intraperitoneal aerosol chemotherapy (PIPAC)business.industryStandard treatmentCommon Terminology Criteria for Adverse EventsMiddle AgedPrognosisSurgerySurvival RateOncologyDoxorubicin030220 oncology & carcinogenesisCohortConventional PCIPeritoneal metastasisPeritoneal Cancer Index030211 gastroenterology & hepatologySurgeryFemaleCisplatinbusinessGastric cancerFollow-Up Studies
researchProduct

Alemtuzumab treatment of multiple sclerosis in real-world clinical practice: A report from a single Italian center

2020

Abstract Background Alemtuzumab, is a compound approved for highly active MS, and, in Europe, employed after the use of other disease-modifying treatments (DMTs) with an escalation approach or used as a first therapeutic option. The occurrence of secondary autoimmune adverse events and or infections can differ depending on the employed approach. Objective To evaluate the efficacy and safety of alemtuzumab in real-world MS population that encompassed patients previously treated with other DMTs. Methods 35 patients, treated with alemtuzumab in a single MS Center, were followed for at least 36 months. The study investigated the prevalence of patients reaching the phase of the non-active diseas…

AdultMalemedicine.medical_specialtyMultiple SclerosisEfficacyPopulationDisease03 medical and health sciences0302 clinical medicineInternal medicinePost-hoc analysisOutcome Assessment Health CaremedicineHumansImmunologic Factors030212 general & internal medicineAdverse effecteducationAlemtuzumabeducation.field_of_studybusiness.industryMultiple sclerosisGeneral MedicineMiddle Agedmedicine.diseasePancytopeniaProgression-Free SurvivalNeurologyItalyAdverse eventsDisease ProgressionAlemtuzumabFemaleSettore MED/26 - NeurologiaNeurology (clinical)Autoimmune hemolytic anemiaSafetybusiness030217 neurology & neurosurgerymedicine.drugFollow-Up Studies
researchProduct

Long-term effects on adult attachment in German occupation children born after World War II in comparison with a birth-cohort-matched representative …

2016

Children born of war are a phenomenon of every conflict. At the end of World War II and thereafter, approximately 400,000 children were fathered by foreign soldiers and born to local women in Germany. Quantitative research on psychosocial consequences of growing up as German occupation child (GOC) has been missing so far.This study examines adult attachment and its association with current depression in GOC (N = 146) using self-report instruments: Adult Attachment Scale, Patient Health Questionnaire. Data were compared to a birth-cohort-matched representative sample of the German population (BCMS; N = 786).GOC differ in both attachment dimensions (less comfortable with closeness/intimacy, l…

AdultMalemedicine.medical_specialtyWorld War IIPopulationPsychological Techniques050109 social psychologyGermanLife Change Events03 medical and health sciences0302 clinical medicineGermanymedicineHumans0501 psychology and cognitive sciencesPsychiatryeducationChildObject Attachmenteducation.field_of_studyPovertyDepression05 social sciencesWorld War IIObject Attachmentlanguage.human_language030227 psychiatryPatient Health QuestionnairePsychiatry and Mental healthAdult Survivors of Child Adverse EventslanguageLife course approachFemaleGeriatrics and GerontologyPshychiatric Mental HealthPsychologyGerontologyPsychosocialAgingmental health
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Association Between ABCB1 Genetic Variants and Persistent Chemotherapy-Induced Alopecia in Women With Breast Cancer

2020

Importance Persistent chemotherapy-induced alopecia (pCIA) has been recently described in patients with breast cancer and in its most severe form occurs in up to 10% of these patients. Genetic risk factors associated with pCIA have not been adequately explored. Objective To identify genetic variants associated with pCIA. Design, Setting, and Participants In this genetic association study, 215 women with breast cancer treated with docetaxel-based chemotherapy with a follow-up of 1.5 to 10 years after the end of the treatment were recruited retrospectively through 3 hospital oncology units across Spain between 2005 and 2018. Severe pCIA was defined as lack of scalp hair recovery (Common Termi…

AdultOncologymedicine.medical_specialtyATP Binding Cassette Transporter Subfamily BBiopsyBreast NeoplasmsGenome-wide association studyDocetaxelDermatologyPolymorphism Single Nucleotide030207 dermatology & venereal diseases03 medical and health sciences0302 clinical medicineBreast cancerRisk FactorsInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineHumansGenetic Predisposition to DiseasePromoter Regions GeneticAdverse effectRetrospective StudiesDose-Response Relationship Drugbusiness.industryAge FactorsCase-control studyAlopeciaCommon Terminology Criteria for Adverse EventsRetrospective cohort studyOdds ratioMiddle Agedmedicine.diseaseEnhancer Elements GeneticDocetaxelCase-Control Studies030220 oncology & carcinogenesisFemalebusinessHair FollicleFollow-Up StudiesGenome-Wide Association Studymedicine.drugJAMA Dermatology
researchProduct

Associations between parental alcohol problems in childhood and adversities during childhood and later adulthood: a cross-sectional study of 28047 ad…

2021

Abstract Background Adverse childhood experiences (ACE) are related to adverse physical and mental health outcomes. However, few larger studies based on a general population sample with age groups ranging from young adults to elderly have investigated whether parental alcohol problems increase the risk of offspring subjective reports of ACE both during childhood and current adult adversities. The purpose of this study was to examine the associations between parental alcohol problems and adversities during childhood and later in adulthood. Methods The 28,047 respondents were adults (> 18 years old) from the general population who participated in the Norwegian Counties Public Health Survey…

AdultParentsmedicine.medical_specialtyAdolescentCross-sectional studyPopulation030508 substance abuseAlcohol drinkingDysfunctional family03 medical and health sciences0302 clinical medicineSocial pathology. Social and public welfare. CriminologyAdverse Childhood ExperiencesRisk FactorsHumansMedicineFamily030212 general & internal medicineYoung adulteducationHV1-9960Agededucation.field_of_studybusiness.industryResearchHealth PolicyPublic healthOdds ratioMental healthVDP::Medical disciplines: 700Psychiatry and Mental healthHealth psychologyCross-Sectional StudiesAdult survivors of child adverse eventsPublic aspects of medicineRA1-12700305 other medical sciencebusinessAlcohol-Related DisordersDemographySubstance Abuse Treatment, Prevention, and Policy
researchProduct