Search results for "AF"

showing 10 items of 23539 documents

Energy transfer in LH2 of Rhodospirillum Molischianum, studied by subpicosecond spectroscopy and configuration interaction exciton calculations.

2001

Two color transient absorption measurements were performed on a LH2 complex from Rhodospirillum molischianum by using several excitation wavelengths (790, 800, 810, and 830 nm) and probing in the spectral region from 790 to 870 nm at room temperature. The observed energy transfer time of ∼1.0 ps from B800 to B850 at room temperature is longer than the corresponding rates in Rhodopseudomonas acidophila and Rhodobacter sphaeroides. We observed variations (0.9-1.2 ps) of B800-850 energy transfer times at different B800 excitation wavelengths, the fastest time (0.9 ps) was obtained with 800 nm excitation. At 830 nm excitation the energy transfer to the B850 ring takes place within 0.5 ps. The m…

/dk/atira/pure/sustainabledevelopmentgoals/affordable_and_clean_energybiologyChemistryExcitonConfiguration interactionbiology.organism_classificationSpectral lineSurfaces Coatings and FilmsRhodobacter sphaeroidesUltrafast laser spectroscopyMaterials ChemistrySDG 7 - Affordable and Clean EnergyPhysical and Theoretical ChemistryAtomic physicsAbsorption (electromagnetic radiation)SpectroscopyExcitation
researchProduct

Injection and ultrafast regeneration in dye-sensitized solar cells

2014

Injection of an electron from the excited dye molecule to the semiconductor is the initial charge separation step in dye-sensitized solar cells (DSC's). Though the dynamics of the forward injection process has been widely studied, the results reported so far are controversial, especially for complete DSC's. In this work, the electron injection in titanium dioxide (TiO2) films sensitized with ruthenium bipyridyl dyes N3 and N719 was studied both in neat solvent and in a typical iodide/triiodide (I-/I3 -) DSC electrolyte. Transient absorption (TA) spectroscopy was used to monitor both the formation of the oxidized dye and the arrival of injected electrons to the conduction band of TiO2. Emiss…

/dk/atira/pure/sustainabledevelopmentgoals/affordable_and_clean_energyta221Analytical chemistrychemistry.chemical_elementElectrolyteNanosecondPhotochemistrySurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsRutheniumDye-sensitized solar cellchemistry.chemical_compoundGeneral EnergychemistryPicosecondTitanium dioxideUltrafast laser spectroscopySDG 7 - Affordable and Clean EnergyPhysical and Theoretical ChemistryTriiodideta116
researchProduct

The effects of environment on Arctica islandica shell formation and architecture

2017

Mollusks record valuable information in their hard parts that reflect ambient environmental conditions. For this reason, shells can serve as excellent archives to reconstruct past climate and environmental variability. However, animal physiology and biomineralization, which are often poorly un- derstood, can make the decoding of environmental signals a challenging task. Many of the routinely used shell-based proxies are sensitive to multiple different environmental and physiological variables. Therefore, the identification and in- terpretation of individual environmental signals (e.g., water temperature) often is particularly difficult. Additional prox- ies not influenced by multiple enviro…

/dk/atira/pure/sustainabledevelopmentgoals/life_below_waterlcsh:Geologylcsh:QH501-531550 Earth scienceslcsh:QH540-549.5lcsh:QE1-996.5lcsh:Lifelcsh:EcologySDG 14 - Life Below Water550 Geowissenschaften
researchProduct

p −1-Linear Maps in Algebra and Geometry

2012

At least since Habousch’s proof of Kempf’s vanishing theorem, Frobenius splitting techniques have played a crucial role in geometric representation theory and algebraic geometry over a field of positive characteristic. In this article we survey some recent developments which grew out of the confluence of Frobenius splitting techniques and tight closure theory and which provide a framework for higher dimension geometry in positive characteristic. We focus on local properties, i.e. singularities, test ideals, and local cohomology on the one hand and global geometric applicatioms to vanishing theorems and lifting of sections on the other.

010102 general mathematicsFrobenius splittingField (mathematics)Algebraic geometryLocal cohomology01 natural sciencesCoherent sheafAlgebraLine bundle0103 physical sciencesGravitational singularity010307 mathematical physics0101 mathematicsTight closureMathematics
researchProduct

Photoluminescence-Based Spatially Resolved Temperature Coefficient Maps of Silicon Wafers and Solar Cells

2020

In this article, we present a method to obtain implied open-circuit voltage images of silicon wafers and cells at different temperatures. The proposed method is then demonstrated by investigating the temperature coefficients of various regions across multicrystalline silicon wafers and cells from different heights of two bricks with different dislocation densities. Interestingly, both low and high temperature coefficients are found in dislocated regions on the wafers. A large spread of temperature coefficient is observed at regions with similar performance at 298 K. Reduced temperature sensitivity is found to be correlated with the increasing brick height and is exhibited by both wafers and…

010302 applied physicsBrickPhotoluminescenceMaterials sciencebusiness.industry02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsReduced properties0103 physical sciencesOptoelectronicsDegradation (geology)WaferElectrical and Electronic EngineeringDislocation0210 nano-technologybusinessTemperature coefficientImage resolutionIEEE Journal of Photovoltaics
researchProduct

A Novel Method for Characterizing Temperature Sensitivity of Silicon Wafers and Cells

2019

In this paper, we present a novel method to obtain temperature dependent lifetime and implied-open-circuit voltage (iV OC ) images of silicon wafers and solar cells. First, the method is validated by comparing the obtained values with global values acquired from lifetime measurements (for wafers) and current-voltage measurements (for cells). The method is then extended to acquire spatially resolved images of iV OC temperature coefficients of silicon wafers and cells. Potential applications of the proposed method are demonstrated by investigating the temperature coefficients of various regions across multi-crystalline silicon wafers and cells from different heights of two bricks with differe…

010302 applied physicsBrickTemperature sensitivityMaterials sciencebusiness.industry02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesReduced propertiesImpurity0103 physical sciencesOptoelectronicsWaferSensitivity (control systems)Dislocation0210 nano-technologybusinessVoltage2019 IEEE 46th Photovoltaic Specialists Conference (PVSC)
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Temperature Coefficients of Crystal Defects in Multicrystalline Silicon Wafers

2020

This article investigates the influence of crystallographic defects on the temperature sensitivity of multicrystalline silicon wafers. The thermal characteristics of the implied open-circuit voltage is assessed since it determines most of the total temperature sensitivity of the material. Spatially resolved temperature-dependent analysis is performed on wafers from various brick positions; intragrain regions, grain boundaries, and dislocation clusters are examined. The crystal regions are studied before and after subjecting the wafers to phosphorus gettering, aiming to alter the metallic impurity concentration in various regions across the wafers. Most intragrain regions and grain boundarie…

010302 applied physicsMaterials scienceCondensed matter physics02 engineering and technologyAtmospheric temperature range021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesCrystallographic defectElectronic Optical and Magnetic MaterialsCrystalGetterImpurity0103 physical sciencesWaferGrain boundaryElectrical and Electronic EngineeringDislocation0210 nano-technologyIEEE Journal of Photovoltaics
researchProduct

Anomalies of dielectric properties and conductivity in single domain LiNbO3:Zn crystals

2016

ABSTRACTA study of the temperature dependence of dielectric constant, conductivity, and piezoelectric modulus in the single-domain state of LiNbO3 crystals modified by Zn admixture at threshold concentration is reported. Unipolarity of the LiNbO3:Zn crystals is observed to increase after treatment of brand-new samples by high-temperature electro-diffusion annealing and by subsequent high-temperature annealing of short-circuited samples. The observed effects are explained as a result of meta-stable residual domains collapsing at high temperature the collapse being assisted by disintegration of charged clusters stabilizing domain walls. The rise of unipolarity is accompanied by anomalies on t…

010302 applied physicsMaterials scienceCondensed matter physicsAnnealing (metallurgy)Lithium niobateMineralogyModulus02 engineering and technologyDielectricConductivity021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesPiezoelectricityElectronic Optical and Magnetic Materialschemistry.chemical_compoundchemistryControl and Systems Engineering0103 physical sciencesMaterials ChemistryCeramics and CompositesElectrical and Electronic EngineeringSingle domain0210 nano-technologyAfter treatmentIntegrated Ferroelectrics
researchProduct

The effect of plasma instabilities on the background impurities in charge breeder ECRIS

2017

International audience; Experimental observations of plasma instabilities in the 14.5 GHz PHOENIX charge breeder ECRIS are summarized. It has been found that the injection of 133Cs+ or 85Rb+ into oxygen discharge of the CB-ECRIS can trigger electron cyclotron instabilities, which results to sputtering of the surfaces exposed to the plasma, followed by up to an order of magnitude increase of impurity currents in the extracted n+ charge state distribution. The transition from stable to unstable plasma regime is caused by gradual accumulation and ionization of Cs/Rb altering the discharge parameters in 10 - 100 ms time scale, not by a prompt interaction between the incident ion beam and the EC…

010302 applied physicsMaterials scienceIon beamta114syklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Buffer gasCyclotronPlasmaElectroncharge breederplasmafysiikka7. Clean energy01 natural sciences010305 fluids & plasmaslaw.inventionIonECRISSputteringlawIonization0103 physical sciencesAtomic physicsplasma (kaasut)plasma
researchProduct