Search results for "Adverse effect"

showing 10 items of 1065 documents

Evaluation of the immediate post-operative procedure after dental intervetions. 24 hours follow up study. epico study

2010

Objectives: The purpose of this study was to make a descriptive approximation of the therapeutic management of the different dental interventions in clinical practice today, and to analyze the degree of consensus among the specialists participating in the study. Study Design: A total of 447 odontologists, stomatologists or maxillofacial surgeons from 43 Spanish provinces participated in the study. The study sample consisted of patients aged 18 years old or over attending the clinic for a dental intervention. The type of intervention carried out and treatments administered before and after the intervention were recorded. At 24 hours after the intervention, intensity of pain experienced by th…

AdultMalemedicine.medical_specialtyTime Factorsmedicine.drug_classOral Surgical ProceduresAnalgesicAntibioticsPsychological interventionOral Surgical ProceduresPostoperative ComplicationsIntervention (counseling)medicineHumansProspective StudiesAdverse effectProspective cohort studyGeneral DentistryPostoperative Carebusiness.industryEndodontics:CIENCIAS MÉDICAS [UNESCO]OtorhinolaryngologyUNESCO::CIENCIAS MÉDICASPhysical therapyFemaleSurgerybusinessFollow-Up Studies
researchProduct

Systemic Treatment with Interferon-α2B: An Effective Method to Prevent Sterility after Bilateral Mumps Orchitis

1991

In men orchitis represents the most common complication of mumps infection and occurs in 5 to 37% of this population. Bilateral manifestation is observed in 16 to 65% of the patients. The most important danger is the risk of testicular atrophy which results in sterility. Four patients with bilateral mumps orchitis received systemic treatment with interferon-alpha 2B (3 x 10(6) IU per day) for 7 days. All acute symptoms of mumps orchitis disappeared within 2 to 4 days of hospitalization. During 6 to 15 months of followup no incidence of testicular atrophy was observed. In 3 of 4 patients pre-treatment examination revealed subfertility (oligoasthenospermia), while 2 to 4 months after interfer…

AdultMalemedicine.medical_specialtyUrologyPopulationAlpha interferonOrchitisInterferon alpha-2TestismedicineHumansProspective StudiesRadionuclide ImagingAdverse effecteducationMumpsInfertility MaleInterferon alfaAcetaminophenUltrasonographyeducation.field_of_studyPalpationTesticular atrophybusiness.industryInterferon-alphamedicine.diseaseRecombinant ProteinsSurgeryConcomitantDrug EvaluationOrchitisComplicationbusinessmedicine.drugJournal of Urology
researchProduct

Antigen-Specific Immunotherapy with Thyrotropin Receptor Peptides in Graves' Hyperthyroidism: A Phase I Study

2019

Background: Graves' disease is one of the most common autoimmune conditions, but treatment remains imperfect. This study explores the first-in-human use of antigen-specific immunotherapy with a combination of two thyrotropin receptor (TSHR) peptides (termed ATX-GD-59) in Graves' hyperthyroidism. Methods: Twelve participants (11 female) with previously untreated mild to moderate Graves' hyperthyroidism were enrolled in a Phase I open label trial to receive 10 doses of ATX-GD-59 administered intradermally over an 18-week period. Adverse events, tolerability, changes in serum free thyroid hormones, and TSHR autoantibodies were measured. Results: Ten subjects received all 10 doses of ATX-GD-59,…

AdultMalemedicine.medical_specialtyendocrine systemendocrine system diseasesInjections Intradermalthyroid stimulating hormone receptorEndocrinology Diabetes and Metabolismmedicine.medical_treatmentGraves' diseasedesensitization030209 endocrinology & metabolismDiseaseImmunology Autoimmunity and Graves’ OphthalmopathyimmunomodulationThyrotropin receptor03 medical and health sciences0302 clinical medicineEndocrinologyInternal medicinemedicineHumansAdverse effectDesensitization (medicine)business.industryAutoantibodypeptide immunotherapyReceptors ThyrotropinImmunotherapyMiddle Agedmedicine.diseaseGraves' diseaseGraves Disease3. Good healthInjection Site ReactionThyroxineEndocrinologyTreatment OutcomeTolerabilityDesensitization Immunologic030220 oncology & carcinogenesisTriiodothyronineFemaleautoimmune thyroid diseasebusinessPeptidesImmunoglobulins Thyroid-StimulatingThyroid
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Efficacy and Safety of Subcutaneous Belimumab in Anti–Double-Stranded DNA–Positive, Hypocomplementemic Patients With Systemic Lupus Erythematosus

2018

Objective: To investigate the efficacy and safety of belimumab, a human immunoglobulin monoclonal antibody against B lymphocyte stimulator, in a subset of patients with systemic lupus erythematosus (SLE) who were hypocomplementemic (C3 <90 mg/dl and/or C4 <10 mg/dl) and anti–double-stranded DNA (anti-dsDNA) positive (≥30 IU/ml) at baseline. Methods: In this phase III, double-blind, placebo-controlled study (BEL112341; ClinicalTrials.gov identifier: NCT01484496), patients with moderate to severe SLE (Safety of Estrogens in Lupus Erythematosus National Assessment version of the Systemic Lupus Erythematosus Disease Activity Index [SELENA–SLEDAI] score ≥8) were randomized (2:1) to receive weekl…

AdultMalemedicine.medical_specialtymedicine.drug_classInjections SubcutaneousPopulationImmunologyPlaceboAntibodies Monoclonal HumanizedGastroenterologySystemic Lupus ErythematosusSeverity of Illness Index03 medical and health sciences0302 clinical medicineDouble-Blind MethodRheumatologyInternal medicinemedicineHumansLupus Erythematosus SystemicImmunology and Allergy030212 general & internal medicineeducationAdverse effectskin and connective tissue diseases030203 arthritis & rheumatologyeducation.field_of_studyLupus erythematosusIntention-to-treat analysisbusiness.industryComplement C3DNAmedicine.diseaseBelimumabRheumatologyIntention to Treat AnalysisTreatment OutcomeAntibodies AntinuclearImmunology and Allergy; Rheumatology; ImmunologyCorticosteroidOriginal ArticleFemalebusinessmedicine.drug
researchProduct

Retinoids and proliferative verrucous leukoplakia (PVL). A preliminary study.

2010

Objective. A study is made of the efficacy and adverse effects of retinoid therapy applied to the white lesions of proliferative verrucous leukoplakia (PVL). Material and methods. The results of retinoid therapy were evaluated in 17 patients diagnosed with PVL. Topical retinoids were used in 5 patients, in the form of two daily applications of 0.1% 13-cis-retinoic acid in orabase for an average of 6.17+/-3.13 months. Systemic retinoids were used in 11 patients, with the administration of 25 mg/day of acitretin in tablet form for an average of 5.41+/-2.02 months. One patient successively received the topical and systemic retinoid formulations. The course and results were evaluated on a blind…

AdultMalemedicine.medical_specialtymedicine.drug_classSystemic therapyAcitretinDesquamationLesionRetinoidsOral and maxillofacial pathologymedicineHumansRetinoidAdverse effectGeneral DentistryLeukoplakiaAgedAged 80 and overbusiness.industryMiddle Agedmedicine.disease:CIENCIAS MÉDICAS [UNESCO]DermatologyOtorhinolaryngologyUNESCO::CIENCIAS MÉDICASSurgeryFemalemedicine.symptomLeukoplakia Oralbusinessmedicine.drugMedicina oral, patologia oral y cirugia bucal
researchProduct

Early results of endovascular treatment of patients with bilateral stenoses of the internal carotid arteries using proximal protection systems at 30-…

2017

Abstract Background Although surgical endarterectomy remains the treatment of choice for carotid artery stenosis, carotid artery stenting (CAS) with use of proximal protection systems (PPS) plays an very important role as alternative treatment modality, especially in patients with critical, symptomatic lesions. This study was single-centre study to evaluate the technical and clinical success of proximal protection devices as the first choice for embolic protection in symptomatic and asymptomatic carotid stenosis in patients with bilateral, advanced lesions of carotid arteries (bilateral stenoses or stenosis and occlusion). Methods This was a post hoc analysis, with 30-day follow up. We anal…

AdultMalemedicine.medical_specialtymedicine.medical_treatment030204 cardiovascular system & hematologyAsymptomatic03 medical and health sciences0302 clinical medicineDiabetes mellitusAngioplastyOcclusionPost-hoc analysismedicineHumansCarotid StenosisAdverse effectAgedRetrospective StudiesCarotidEndarterectomyProtectionbusiness.industryEndovascular ProceduresAngioplastySystemsProximalangioplastyMiddle Agedprotectionmedicine.diseaseSurgerycarotidStenosisproximalIntracranial EmbolismstentssystemsFemaleStentsSurgeryNeurology (clinical)Radiologymedicine.symptombusiness030217 neurology & neurosurgeryNeurologia i Neurochirurgia Polska
researchProduct

Treatment of psoriasis with the chimeric monoclonal antibody against tumor necrosis factor alpha, infliximab.

2002

Abstract Background: Psoriatic skin lesions in patients with Crohn's disease or psoriatic arthritis have shown improvement during infliximab treatment. Objective: The purpose of our study was to systematically assess the effects of infliximab in patients with psoriatic skin lesions. Methods: Eight patients with severe psoriasis were enrolled in an open-label clinical trial. Patients received infliximab, 5 mg/kg, intravenously at weeks 0, 2, and 6. The Psoriasis Area and Severity Index (PASI) was used to monitor disease activity at weeks 0, 2, 4, 6, 8, 10, and 14. Week 10 was the end point of the treatment phase; week 14 was the follow-up end point. Pruritus was assessed on a scale of 0 to 3…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentAcanthosisDermatologyGastroenterologySeverity of Illness IndexPsoriatic arthritisPsoriasis Area and Severity IndexInternal medicinePsoriasisBiopsymedicineHumansPsoriasisAdverse effectInfusions IntravenousChemotherapymedicine.diagnostic_testbusiness.industryTumor Necrosis Factor-alphaAntibodies MonoclonalMiddle Agedmedicine.diseaseInfliximabInfliximabSurgeryTreatment OutcomeFemaleDermatologic Agentsbusinessmedicine.drugJournal of the American Academy of Dermatology
researchProduct

Effects of a nonsurgical exercise program on the decreased mouth opening in patients with systemic scleroderma.

2004

The decreased mouth opening (microstomia) represents a frequent finding in patients with systemic scleroderma (SSD), but little information is available about the efficacy of nonsurgical management of this condition. The aim of this study is to assess the effects of a nonsurgical exercise program on the decreased mouth opening in a group of 10 SSD patients with severe microstomia (maximal mouth opening 0.1). At the end of the 18-week period, all patients commented that eating, speaking and oral hygiene measures were easier. The edentulous subjects also experienced less difficulty inserting their own dentures. These findings suggest that regular application of the proposed exercise program m…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentDentistryFacial MusclesSystemic sclerodermaOral hygieneStatistics NonparametricEatingPatient satisfactionSettore MED/28 - Malattie OdontostomatologicheMicrostomiamedicineDentitionHumansSpeechIn patientAdverse effectGeneral DentistryAgedsystemic sclerosis nonsurgical exerciseMouthScleroderma SystemicDentitionDenture Completebusiness.industryMicrostomiaMiddle Agedmedicine.diseaseOral HygieneExercise TherapyPatient SatisfactionPhysical therapyFemaleDenturesMouth EdentulousbusinessFollow-Up Studies
researchProduct

Phenprocoumon-induced liver disease ranges from mild acute hepatitis to (sub-) acute liver failure

2003

Abstract Background/Aims Except for bleeding complications, other serious adverse reactions of coumarin anticoagulants such as hepatotoxicity or skin necrosis are comparatively rare. Nonetheless, a small number of coumarin-induced (sub-) acute liver failures has been published. Methods A retrospective analysis was performed of patients treated for liver disease between 1992 and 2002 at our department to evaluate the incidence, clinical findings and histopathology of coumarin-induced hepatotoxicity. Results The retrospective analysis revealed eight cases of phenprocoumon-induced hepatotoxicity, including three cases of (sub-) acute liver failure which resulted in two orthotopic liver transpl…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentLiver transplantationSeverity of Illness IndexGastroenterologyPhenprocoumonLiver diseaseGermanyInternal medicinemedicineHumansAdverse effectRetrospective StudiesHepatitisLiver injuryHepatologybusiness.industryLiver cellAnticoagulantsLiver Failure AcuteMiddle Agedmedicine.diseaseSurgeryAcute DiseasePhenprocoumonFemaleChemical and Drug Induced Liver InjuryComplicationbusinessmedicine.drugJournal of Hepatology
researchProduct