Search results for "Aino"

showing 10 items of 539 documents

Standing time and daily proportion of sedentary time are associated with pain-related disability in a one month accelerometer measurement in adults w…

2022

Abstract Objectives: The association between the subjective experience of pain-related disability (PRD) and device-measured physical activity (PA) and sedentary behavior (SB) in overweight and obese adults is not well known. The aim of this study was to investigate the associations of pain markers with accelerometer-measured SB duration and different intensities of PA among physically inactive middle-aged adults with overweight or obesity. Methods: This cross-sectional analysis included 72 subjects (27 men) with mean age of 57.9 (SD 6.7) years and mean BMI of 31.6 (SD 4.1) kg/m². SB and standing time (ST), breaks in sedentary time, light physical activity (LPA) and moderate-to-vigorous phys…

functional performanceaccelerometrylihavuuskipuoverweightsedentary behavior (SB)liikuntarajoitteetylipainopainaskelmittaritfyysinen aktiivisuus
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Physical disability in community-dwelling older people after hip fracture : randomized controlled trials with physical rehabilitation

2013

fyysinen toimintakykytasapainophysical activityfunctional capacityelderlyfysioterapiakotona asuminenrehabilitationmurtumatfallsphysical therapypelkoPhysical Therapy ModalitiesAgedkaatuminenexerciseHip FracturesagingbalancefractureslonkkaKyselytutkimusikääntyminendisabilitykuntoutusvoimaharjoitteluliikkuminenresistance trainingactivities of daily livingikääntyneet
researchProduct

Iloisia lapsia Onnelassa : lapsuus ja perhe-elämä TV-mainoksissa

1997

gendermainosperhelapsuusyksilöllisyys
researchProduct

Body size at birth and age-related macular degeneration in old age

2019

Purpose To study associations between body size at birth and age-related macular degeneration (AMD) in old age. Methods The study sample consists of 1497 community-dwelling individuals (56.1% women) aged 67-89 years with birth data and retinal data collected twice in old age 5 years apart. Birth data (weight, length, birth order) were extracted from original birth records. Digital retinal photographs were graded to determine AMD status. Data on covariates were collected at the baseline physical examination in old age. Multivariable regression analyses were used to study the association between birth data and AMD adjusting for known confounding factors, including birth year cohort effects. R…

genetic structuresMACULOPATHYPopulationArticle03 medical and health sciences0302 clinical medicineMedicinesyntymäpainoCORONARY-HEART-DISEASE3125 Otorhinolaryngology ophthalmology10. No inequalityeducationage-related macular degenerationBirth YearPOPULATIONeducation.field_of_studyHYPERTENSIONbusiness.industryIncidence (epidemiology)age‐related macular degenerationGeneral MedicineMacular degenerationbody size at birthmedicine.diseaseObesityeye diseasessilmänpohjan ikärappeumaPREVALENCELIFEOphthalmologyBirth orderCohort effectQuartile030221 ophthalmology & optometrySUBSEQUENT RISKsense organsWEIGHTbusiness030217 neurology & neurosurgeryDemography
researchProduct

Socioecological correlates of perceived motor competence in 5- to 7-year-old Finnish children

2019

We investigated child, family, and environmental factors associated with young children’s perceptions of locomotor (LM) and object control (OC) skills. The participants comprised 472 children (6.22 ± 0.63) and their parents. The children were assessed for their perception of motor competence in LM and OC skills (using the pictorial scale of Perceived Movement Skill Competence for young children), and actual motor competence (Test of Gross Motor Development 3rd edition and Körperkoordinationstest Für Kinder). Anthropometrics were calculated using the children’s body mass index standard deviation scores. A parent questionnaire included questions about child factors (sex, child’s independent w…

genetic structuresTGMD-3childcare centreympäristötekijätitsetuntemuseducationbehavioral disciplines and activitiesself-perceptionBMIlocomotor skillsesikouluikäisetpainoindeksiobject control skillsmotoriset taidotKTK
researchProduct

Yksilön yhteiskunnallinen paino : vapauden ja hallinnan tarkastelua Helsingin Sanomien Läskikapina-kampanjassa

2008

Pro gradu-tutkielma tarkastelee ylipainon yhteiskunnallista hallintaa kansanterveydellisenä ongelmana nykypäivän Suomessa, sekä myös yleisemmin yksilön terveyden ja omien valintojen yhteiskunnallista merkitystä. Tutkimusaineistona on Helsingin Sanomien vuoden 2007 keväällä julkaisema Läskikapina-kampanja, yhteensä 53 sanomalehtiartikkelia, jotka tarkastelivat ylipaino-ongelmaa globaalina ilmiönä eri näkökulmista. Tutkielman tarkoituksena on löytää aineistosta diskurssianalyysiä ja kriittistä lukutapaa käyttäen syitä ylipainon hallinnallisuuden problematiikkaan ja kompleksiseen luonteeseen. Teoriataustan muodostavat vapauskäsite pohjautuen Isaiah Berlinin ja Quentin Skinnerin teksteihin, sek…

hallintahyvinvointivaltiokansanterveysylipainobiopolitiikkavapausasiantuntijuus
researchProduct

Energy expenditure and substrate utilization during eccentric exercise in obese and diabetics

2008

harjoittelulihavuusenergiankulutusylipaino
researchProduct

Re-thinking Nicholas J. Spykman : from historical sociology to balance of power

2020

This article examines Nicholas J. Spykman’s scholarship beyond geopolitics and International Relations (IR). Because his works have mainly been studied through these prisms, I argue that we have overlooked the most important underlying current of his work: historical sociology. As a result, the prevailing view of him is overtly narrow. When Spykman’s scholarly output is examined from the 1920s to 1940s, an entirely different view of Spykman emerges. Essentially, his fundamental understanding of world affairs derived from the German sociologist Georg Simmel’s theories. In the 1920s and 1930s, Spykman transmuted these underpinnings into IR that later in the 1940s guided his two major works: A…

historical turnhistorical sociologyeristys (eristäminen muista)balance of powerkansainväliset suhteetgeopoliticsgeopolitiikkaNicholas J. Spykmanrimlandvoimatasapainocontainmentkansainvälisyyshistoriallinen sosiologiainternationalismisolationismSpykman Nicholas J.
researchProduct

Lihasten voimantuoton yhteys tasapainokontrolliin dynaamisessa tasapainohäiriössä nuorilla miehillä ja naisilla

2016

Poikkimäki, Pirjo (2016). Lihasten voimantuoton yhteys tasapainokontrolliin dynaamisessa tasapainohäiriössä nuorilla miehillä ja naisilla. Liikuntabiologian laitos, Jyväskylän yliopisto. Biomekaniikan Pro gradu -tutkielma, 71s. Tasapaino on oleellinen osa ihmisen jokapäiväistä arkea. Sen säilyttäminen on joko tiedostamatonta tai tiedostettua hermo-lihasjärjestelmän avulla tapahtuvaa kokonaisvaltaista toimintaa. Tasapaino kehittyy luonnollisesti yksilön kasvamisen myötä, toisaalta sen harjoittelu on ensiarvoisen tärkeää loukkaantumisten ehkäisemiseksi erityisesti ikääntyneillä. Tässä tutkimuksessa selvitettiin tasapainokontrollin yhteyttä lihasten voimantuottoon dynaamisessa tasapainohäiriös…

häiriöttasapainotutkimussCOP
researchProduct