Search results for "Applied Physics"

showing 10 items of 1226 documents

On the Effect of Surface Treatment to Improve Oxidation Resistance and Conductivity of Metallic Interconnects for SOFC in Operating Conditions

2008

International audience; Due to the reduction of operating temperature from 1000°C to 800°C, chromia forming alloys are the best candidates for interconnects in Solid Oxide Fuel Cells (SOFCs). These interconnects have to be operational in service conditions, at 800°C in air (cathode side) and in humidified hydrogen (anode side). The performance of the interconnect stainless steels is limited by the oxide scale formation (chromia), the low electronic conductivity of this scale and the possible volatility of chromium oxides. In the field of high temperature oxidation of metals, it is well known that the addition of a nanometric layer made of reactive element oxide such as, La2O3, Nd2O3 and Y2O…

[CHIM.INOR] Chemical Sciences/Inorganic chemistryMaterials scienceOxide02 engineering and technologyChemical vapor deposition[CHIM.INOR]Chemical Sciences/Inorganic chemistryConductivityengineering.material01 natural sciencesCorrosionlaw.inventionchemistry.chemical_compoundCoatinglaw0103 physical sciencesGeneral Materials ScienceSOFC010302 applied physicsreactive elementinterconnectMechanical EngineeringMetallurgy[ CHIM.INOR ] Chemical Sciences/Inorganic chemistry021001 nanoscience & nanotechnologyCondensed Matter PhysicsChromiaCathodeAnodechemistryMechanics of MaterialsMOCVDengineering0210 nano-technologyMaterials Science Forum
researchProduct

Prospects for advanced electron cyclotron resonance and electron beam ion source charge breeding methods for EURISOL

2011

International audience; As the most ambitious concept of isotope separation on line (ISOL) facility, EURISOL aims at producing unprecedented intensities of post-accelerated radioactive isotopes. Charge breeding, which transforms the charge state of radioactive beams from 1+ to an n+ charge state prior to postacceleration, is a key technology which has to overcome the following challenges: high charge states for high energies, efficiency, rapidity and purity. On the roadmap to EURISOL, a dedicated R&D is being undertaken to push forward the frontiers of the present state-of-the-art techniques which use either electron cyclotron resonance or electron beam ion sources. We describe here the gui…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceplasmafysiikka01 natural sciences7. Clean energyElectron cyclotron resonanceIonlaw.inventionIsotope separationelectron beamsNuclear physicsEURISOLion sourceslaw0103 physical sciencescyclotron resonance010306 general physicsradioactive ion beamsradioactive beamInstrumentation010302 applied physicsPhysicsta11429.25.Ni 41.75.Fr 07.77.KaionilähteetParticle acceleratorradioaktiiviset suihkutIon sourceCathode rayAtomic physicsydinfysiikkaIon cyclotron resonance
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Single-mode room-temperature emission with a silicon rod lattice

2006

The authors experimentally evidence an increase of light emission efficiency at room temperature in a silicon-on-insulator photonic crystal. The photonic crystal is made of a triangular lattice of silicon rods and operates as a single-mode light extractor. It exhibits a luminescence intensity two orders of magnitude higher than silicon-on-insulator substrate. In light of photoluminescence experiments, emission diagram measurements, and finite difference time domain calculations, they identify the different optical properties of the photonic crystal and they demonstrate the existence of at least a fivefold emission efficiency enhancement per surface unit.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Materials sciencePhotoluminescence[SPI.OPTI] Engineering Sciences [physics]/Optics / PhotonicPhysics and Astronomy (miscellaneous)Silicon[SPI.NANO] Engineering Sciences [physics]/Micro and nanotechnologies/MicroelectronicsPhysics::Opticschemistry.chemical_elementSilicon on insulator02 engineering and technology[SPI.MAT] Engineering Sciences [physics]/Materials7. Clean energy01 natural sciences[SPI.MAT]Engineering Sciences [physics]/Materials0103 physical sciencesHexagonal lattice[SPI.NANO]Engineering Sciences [physics]/Micro and nanotechnologies/MicroelectronicsComputingMilieux_MISCELLANEOUSPhotonic crystal010302 applied physics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]business.industry[SPI.ELEC] Engineering Sciences [physics]/Electromagnetism021001 nanoscience & nanotechnologyYablonovite[PHYS.COND.CM-MS] Physics [physics]/Condensed Matter [cond-mat]/Materials Science [cond-mat.mtrl-sci][SPI.TRON] Engineering Sciences [physics]/Electronics[SPI.TRON]Engineering Sciences [physics]/Electronics[SPI.ELEC]Engineering Sciences [physics]/Electromagnetismchemistry[PHYS.COND.CM-MS]Physics [physics]/Condensed Matter [cond-mat]/Materials Science [cond-mat.mtrl-sci][SPI.OPTI]Engineering Sciences [physics]/Optics / PhotonicOptoelectronicsLight emission0210 nano-technologybusinessLuminescence
researchProduct

Nanobox array for silicon-on-insulator luminescence enhancement at room temperature

2006

We report the light extraction enhancement obtained at room temperature from a square lattice of crystalline silicon nanoboxes etched in a silicon-on-insulator substrate. Luminescence spectra recorded under optical pumping show a 125 times emission enhancement as compared with the reference unpatterned silicon-on-insulator emission. In light of band diagram calculations, it is demonstrated that the emission enhancement partially results from the coupling between electron-hole recombination inside the silicon boxes and low group velocity optical modes of the array. Moreover, it is observed that these modes present different decoupling lengths and that a complete extraction of luminescence ca…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Materials sciencePhysics and Astronomy (miscellaneous)Silicon[SPI.OPTI] Engineering Sciences [physics]/Optics / Photonic[SPI.NANO] Engineering Sciences [physics]/Micro and nanotechnologies/Microelectronicschemistry.chemical_elementSilicon on insulator02 engineering and technologySubstrate (electronics)[SPI.MAT] Engineering Sciences [physics]/Materials01 natural sciences[SPI.MAT]Engineering Sciences [physics]/MaterialsOptical pumping0103 physical sciencesBand diagramCrystalline silicon[SPI.NANO]Engineering Sciences [physics]/Micro and nanotechnologies/MicroelectronicsComputingMilieux_MISCELLANEOUS010302 applied physics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]business.industry[SPI.ELEC] Engineering Sciences [physics]/Electromagnetism021001 nanoscience & nanotechnology[PHYS.COND.CM-MS] Physics [physics]/Condensed Matter [cond-mat]/Materials Science [cond-mat.mtrl-sci][SPI.TRON] Engineering Sciences [physics]/Electronics[SPI.TRON]Engineering Sciences [physics]/Electronics[SPI.ELEC]Engineering Sciences [physics]/Electromagnetismchemistry[PHYS.COND.CM-MS]Physics [physics]/Condensed Matter [cond-mat]/Materials Science [cond-mat.mtrl-sci][SPI.OPTI]Engineering Sciences [physics]/Optics / PhotonicOptoelectronicsGroup velocity0210 nano-technologyLuminescencebusiness
researchProduct

Fano-resonances in High Index Dielectric Nanowires for Directional Scattering

2018

High refractive index dielectric nanostructures provide original optical properties thanks to the occurrence of size- and shape-dependent optical resonance modes. These modes commonly present a spectral overlap of broad, low-order modes (\textit{e.g}. dipolar modes) and much narrower, higher-order modes. The latter are usually characterized by a rapidly varying frequency-dependent phase, which - in superposition with the lower order mode of approximately constant phase - leads to typical spectral features known as Fano resonances. Interestingly, such Fano resonances occur in dielectric nanostructures of the simplest shapes. In spheroidal nanoparticles, interference between broad magnetic di…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics][SPI.OPTI] Engineering Sciences [physics]/Optics / Photonic[SPI.NANO] Engineering Sciences [physics]/Micro and nanotechnologies/MicroelectronicsMie scatteringNanowireFOS: Physical sciencesPhysics::OpticsApplied Physics (physics.app-ph)02 engineering and technologyDielectric01 natural sciences010309 opticsMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciences[SPI.NANO]Engineering Sciences [physics]/Micro and nanotechnologies/Microelectronics[PHYS.COND.CM-MSQHE]Physics [physics]/Condensed Matter [cond-mat]/Mesoscopic Systems and Quantum Hall Effect [cond-mat.mes-hall]Physics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Condensed Matter - Mesoscale and Nanoscale PhysicsCondensed matter physicsScatteringFano resonancePhysics - Applied PhysicsCondensed Matter::Mesoscopic Systems and Quantum Hall Effect021001 nanoscience & nanotechnology[PHYS.COND.CM-MSQHE] Physics [physics]/Condensed Matter [cond-mat]/Mesoscopic Systems and Quantum Hall Effect [cond-mat.mes-hall]Dipole[SPI.OPTI]Engineering Sciences [physics]/Optics / Photonic0210 nano-technologyMultipole expansionMagnetic dipole
researchProduct

Hybrid multiple diffraction in semipolar wurtzite materials: (\bf 01\overline{1}2)-oriented ZnMgO/ZnO heterostructures as an illustration

2017

X-ray diffraction has been widely used to characterize the structural properties (strain and structural quality) of semiconductor heterostructures. This work employs hybrid multiple diffraction to analyzer-oriented Zn1−xMgxO layers grown by molecular beam epitaxy on ZnO substrates. In such a low-symmetry material system, additional features appear in symmetric reflection scans, which are described as arising from hybrid multiple diffraction. First, the Bragg conditions necessary for these high-order processes to occur are introduced and applied to explain all the observed satellite reflections, identify the planes that contribute and computea priorithe angles at which they are observed. Fur…

[PHYS]Physics [physics]010302 applied physicsDiffractionMaterials sciencebusiness.industryX-ray multiple diffractionHeterojunction02 engineering and technologyMultiple diffraction021001 nanoscience & nanotechnology01 natural sciencesGeneral Biochemistry Genetics and Molecular BiologyReciprocal latticehybrid peaksLattice (order)0103 physical sciencesOptoelectronicsA priori and a posteriori0210 nano-technologybusinessWurtzite crystal structureMolecular beam epitaxyJournal of Applied Crystallography
researchProduct

Swarming of micron-sized hematite cubes in a rotating magnetic field -- Experiments

2020

Energy input by under-field rotation of particles drives the systems to emergent non-equilibrium states. Here we investigate the suspension of rotating magnetic cubes. Micron-sized hematite cubes are synthesized and observed microscopically. When exposed to a rotating magnetic field, they form rotating swarms that interact with each other like liquid droplets. We describe the swarming behaviour and its limits and characterize swarm size and angular velocity dependence on magnetic field strength and frequency. A quantitative agreement with a theoretical model is found for the angular velocity of swarms as a function of field frequency. It is interesting to note that hematite particles with p…

[PHYS]Physics [physics]010302 applied physicsRotating magnetic fieldMaterials scienceSwarming (honey bee)Swarm behaviourFOS: Physical sciencesAngular velocity02 engineering and technologyField frequencyHematiteCondensed Matter - Soft Condensed Matter021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesMolecular physicsElectronic Optical and Magnetic MaterialsMagnetic fieldvisual_art0103 physical sciencesvisual_art.visual_art_medium[CHIM]Chemical SciencesMagnetic nanoparticlesSoft Condensed Matter (cond-mat.soft)0210 nano-technology
researchProduct

Guidance of surface elastic waves along a linear chain of pillars

2016

International audience; The propagation of surface elastic waves, or surface phonons, is considered along a linear and periodic chain of cylindrical pillars sitting on a semi-infinite solid substrate. A variety of guided modes, some of them exhibiting a very low group velocity, are shown to exist at frequencies close to the resonance frequencies of the pillars. Although the pillar diameter is typically smaller than half the relevant wavelength, lateral radiation on the surface is found to be canceled. Surface guidance is explained by the hybridization of the resonating pillars with the continuum of elastic waves of the substrate.

[SPI.ACOU]Engineering Sciences [physics]/Acoustics [physics.class-ph]010302 applied physicsMaterials scienceCondensed matter physicsbusiness.industryPhononPillarGeneral Physics and Astronomy02 engineering and technologyRadiation021001 nanoscience & nanotechnology01 natural scienceslcsh:QC1-999[SPI.MAT]Engineering Sciences [physics]/MaterialsWavelengthLove waveSolid substrateAcoustic wave propagationOptics0103 physical sciencesGroup velocity[SPI.NANO]Engineering Sciences [physics]/Micro and nanotechnologies/Microelectronics0210 nano-technologybusinesslcsh:PhysicsAIP Advances
researchProduct

Guiding and confinement of interface acoustic waves in solid-fluid pillar-based phononic crystals

2016

International audience; Pillar-based phononic crystals exhibit some unique wave phenomena due to the interaction between surface acoustic modes of the substrate and local resonances supported by pillars. In this paper, we extend the investigations by taking into account the presence of a liquid medium. We particularly demonstrate that local resonances dramatically decrease the phase velocity of Scholte-Stoneley wave, which leads to a slow wave at the solid/fluid interface. Moreover, we show that increasing the height of pillars introduces a new set of branches of interface modes and drastically affects the acoustic energy localization. Indeed, while some modes display a highly confined pres…

[SPI.ACOU]Engineering Sciences [physics]/Acoustics [physics.class-ph]010302 applied physicsPhysical acousticsMaterials scienceAcousticsMicrofluidicsSurface acoustic waveGeneral Physics and Astronomy02 engineering and technologyAcoustic waveMechanics021001 nanoscience & nanotechnologyIon acoustic wave01 natural scienceslcsh:QC1-999Finite element method[SPI.MAT]Engineering Sciences [physics]/MaterialsPhysics::Fluid Dynamics0103 physical sciences[SPI.NANO]Engineering Sciences [physics]/Micro and nanotechnologies/MicroelectronicsPhase velocity0210 nano-technologylcsh:PhysicsAcoustic resonanceAIP Advances
researchProduct