Search results for "Atom"

showing 10 items of 31559 documents

Discrete spectral incoherent solitons in nonlinear media with noninstantaneous response

2011

International audience; We show theoretically that nonlinear optical media characterized by a finite response time may support the existence of discrete spectral incoherent solitons. The structure of the soliton consists of three incoherent spectral bands that propagate in frequency space toward the low-frequency components in a discrete fashion and with a constant velocity. Discrete spectral incoherent solitons do not exhibit a confinement in the space-time domain, but exclusively in the frequency domain. The kinetic theory describes in detail all the essential properties of discrete spectral incoherent solitons: A quantitative agreement has been obtained between simulations of the kinetic…

01 natural sciencesoptical instabilitiesSchrödinger equation010309 opticssymbols.namesakeand lossesQuantum mechanics0103 physical sciencesDispersion (optics)Dynamics of nonlinear optical systemsOptical solitonssolitons010306 general physicsPropagationNonlinear Schrödinger equationNonlinear Sciences::Pattern Formation and SolitonsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]and optical spatio-temporal dynamicsscatteringWave equationAtomic and Molecular Physics and OpticsSupercontinuumNonlinear systemFrequency domainsymbolsoptical chaos and complexitySolitonnonlinear guided waves
researchProduct

Controlled turbulence regime of electron cyclotron resonance ion source for improved multicharged ion performance

2020

Fundamental studies of excitation and non-linear evolution of kinetic instabilities of strongly nonequlibrium hot plasmas confined in open magnetic traps suggest new opportunities for fine-tuning of conventional electron cyclotron resonance (ECR) ion sources. These devices are widely used for the production of particle beams of high charge state ions. Operating the ion source in controlled turbulence regime allows increasing the absorbed power density and therefore the volumetric plasma energy content in the dense part of the discharge surrounded by the ECR surface, which leads to enhanced beam currents of high charge state ions. We report experiments at the ECR ion source at the JYFL accel…

010302 applied physicsAccelerator Physics (physics.acc-ph)Materials scienceAcoustics and UltrasonicsIon beamFOS: Physical sciencesPlasmaCondensed Matter PhysicsKinetic energy7. Clean energy01 natural sciencesElectron cyclotron resonanceIon sourcePhysics - Plasma Physics010305 fluids & plasmasSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsIonPlasma Physics (physics.plasm-ph)Physics::Plasma Physics0103 physical sciencesPhysics - Accelerator PhysicsAtomic physicsExcitationBeam (structure)
researchProduct

Effect of space charge on the negative oxygen flux during reactive sputtering

2017

Negative ions often play a distinctive role in the phase formation during reactive sputter deposition. The path of these high energetic ions is often assumed to be straight. In this paper, it is shown that in the context of reactive magnetron sputtering space charge effects are decisive for the energetic negative ion trajectories. To investigate the effect of space charge spreading, reactive magnetron sputter experiments were performed in compound mode with target materials that are expected to have a high secondary ion emission yield (MgO and CeO2). By the combination of energy flux measurements, and simulations, a quantitative value for the negative oxygen ion yield can be derived.

010302 applied physicsAcoustics and UltrasonicsChemistryEnergy fluxContext (language use)02 engineering and technologySputter deposition021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesSpace chargeMolecular physicsSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsIonCondensed Matter::Materials SciencePhysics::Plasma PhysicsSputteringYield (chemistry)0103 physical sciencesOxygen fluxAtomic physics0210 nano-technologyJournal of Physics D: Applied Physics
researchProduct

Coloration mechanism of electrochromic Na x WO3 thin films

2019

International audience; The coloration mechanism of tungsten trioxide (WO3) upon insertion of alkali ions is still under debate after several decades of research. This Letter provides new insights into the reversible insertion and coloration mechanisms of Na+ ions in WO3 thin films sputter-deposited on ITO/glass substrates. A unique model based on a constrained spline approach was developed and applied to draw out ε1+iε2 from spectroscopic ellipsometry data from 0.6 to 4.8 eV whatever the state of the electrochromic active layer, i.e. as-deposited, colored or bleached. It is shown that electrochemically intercalated sodium-tungsten trioxide, NaxWO3 (x=0.1, 0.2, 0.35), exhibits an absorption…

010302 applied physicsAlkali ions[PHYS]Physics [physics]Materials sciencebusiness.industry02 engineering and technology021001 nanoscience & nanotechnologyPhotochemistry01 natural sciencesTungsten trioxideAtomic and Molecular Physics and OpticsActive layerIonchemistry.chemical_compoundOpticschemistryElectrochromismAbsorption band0103 physical sciences[CHIM]Chemical SciencesThin film0210 nano-technologybusinessTrioxide
researchProduct

Evolution of the microstructure of sputter deposited TaAlON thin films with increasing oxygen partial pressure

2021

Abstract Recently, quaternary oxynitrides of transition metals and aluminum have attracted increasing interest due to their tunable properties. Within the present work, a series of TaAl(O)N films was sputter deposited using constant nitrogen and varying oxygen partial pressures. The films were grown from single element Ta and Al targets. The deposition parameters were adjusted to obtain a Ta/Al atomic ratio of ~50/50 for the oxygen-free film and were held constant for the following depositions, with the exception of the increasing oxygen partial pressure and compensatory decreasing argon partial pressure. Elastic recoil detection analysis revealed oxygen contents of up to ~26 at.%, while th…

010302 applied physicsArgonMaterials scienceAnalytical chemistrychemistry.chemical_element02 engineering and technologySurfaces and InterfacesGeneral ChemistryPartial pressureNanoindentation021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesOxygenNanocrystalline materialSurfaces Coatings and FilmsElastic recoil detectionchemistry0103 physical sciencesMaterials ChemistryAtomic ratioThin film0210 nano-technologySurface and Coatings Technology
researchProduct

Comparative Theoretical Analysis of BN Nanotubes Doped with Al, P, Ga, As, In, and Sb

2013

SUMMARY AND CONCLUDING REMARKS We have performed large-scale first-principles calculations ofthe electronic structure of (5,5) boron nitride nanotubescontaining the following substitutional impurity atoms: Al, P,Ga, As, In, and Sb. Calculations have been performed using thetwo methods: (i) linear combination of atomic orbitals(LCAO) with the atomic-centered Gaussian-type functions asa basis set and (ii) linearized augmented cylindrical wave(LACW) accompanied with the local density functional andmuffin-tin approximations for the electronic potential. In arelatively good qualitative agreement, both methods predict lowformation energies and, thus, relative stability of point defectsthat are assoc…

010302 applied physicsChemistryBand gap02 engineering and technologyElectronic structure021001 nanoscience & nanotechnology01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsBond lengthchemistry.chemical_compoundGeneral EnergyBoron nitrideLinear combination of atomic orbitals0103 physical sciencesDensity of statesPhysical and Theoretical ChemistryAtomic physics0210 nano-technologyElectronic band structureBasis setThe Journal of Physical Chemistry C
researchProduct

Dielectric response of BaTiO3 electronic states under AC fields via microsecond time-resolved X-ray absorption spectroscopy

2021

Abstract For the first time, the dielectric response of a BaTiO 3 thin film under an AC electric field is investigated using microsecond time-resolved X-ray absorption spectroscopy at the Ti K-edge in order to clarify correlated contributions of each constituent atom on the electronic states. Intensities of the pre-edge e g peak and shoulder structure just below the main edge increase with an increase in the amplitude of the applied electric field, whereas that of the main peak decreases in an opposite manner. Based on the multiple scattering theory, the increase and decrease of the e g and main peaks are simulated for different Ti off-center displacements. Our results indicate that these s…

010302 applied physicsCondensed Matter - Materials ScienceX-ray absorption spectroscopyMaterials sciencePolymers and PlasticsAbsorption spectroscopyMetals and AlloysMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciences02 engineering and technologyElectronic structure021001 nanoscience & nanotechnology01 natural sciencesFerroelectricityMolecular physicsElectronic Optical and Magnetic MaterialsIonMicrosecondElectric field0103 physical sciencesAtomCeramics and Composites0210 nano-technologyActa Materialia
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Low energy nano diffraction (LEND) – A versatile diffraction technique in SEM

2019

Abstract Electron diffraction is a powerful characterization method that is used across different fields and in different instruments. In particular, the power of transmission electron microscopy (TEM) largely relies on the capability to switch between imaging and diffraction mode enabling identification of crystalline phases and in-depth studies of crystal defects, to name only examples. In contrast, while diffraction techniques have found their way into the realm of scanning electron microscopy (SEM) in the form of electron backscatter diffraction and related techniques, on-axis transmission diffraction is still in its infancy. Here we present a simple but versatile setup that enables a ‘…

010302 applied physicsDiffractionMaterials scienceGrapheneScanning electron microscopebusiness.industry02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesCrystallographic defectAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionCharacterization (materials science)Electron diffractionlawTransmission electron microscopy0103 physical sciencesOptoelectronics0210 nano-technologybusinessInstrumentationElectron backscatter diffractionUltramicroscopy
researchProduct

Fast-ADT: A fast and automated electron diffraction tomography setup for structure determination and refinement.

2020

Abstract Electron crystallography has focused in the last few years on the analyses of microcrystals, mainly organic compounds, triggered by recent publications on acquisition methods based on direct detection cameras and continuous stage tilting. However, the main capability of a transmission electron microscope is the access to features at the nanometre scale. In this context, a new acquisition method, called fast and automated diffraction tomography (Fast-ADT), has been developed in form of a general application in order to get the most of the diffraction space from a TEM. It consists of two subsequent tilt scans of the goniometric stage; one to obtain a crystal tracking file and a secon…

010302 applied physicsDiffractionMaterials scienceMicroscopeElectron crystallographybusiness.industryContext (language use)02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionDiffraction tomographyOpticsElectron diffractionlawGoniometer0103 physical sciences0210 nano-technologybusinessInstrumentationPowder diffractionUltramicroscopy
researchProduct