Search results for "CAM"

showing 10 items of 4055 documents

Chapitre XIV. Du Néolithique final au Bronze ancien : les sépultures individuelles campaniformes dans le sud de la France

2011

sépulturefunéraire[SHS.ARCHEO] Humanities and Social Sciences/Archaeology and Prehistory[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and Prehistoryâge du Bronze[ SHS.ARCHEO ] Humanities and Social Sciences/Archaeology and PrehistoryNéolithiqueFrancecampaniforme
researchProduct

Learning styles module as a part of a virtual campus

2016

For several years now, learning style mapping has been carried out for our students of the master's degree education in information technology. To better utilize learning styles in practice, a learning style module was integrated into the multimedia platform used in the education. The learning style module serves both the student and the educator. The goal was to create an application which, in the long run, would diversify the learning environment and make learning more efficient. This study describes the functioning and integration of the learning style application. The deployment of the application is monitored by collecting statistics of its use and feedback of its usability and usefuln…

ta113MultimediaComputer scienceLearning environment05 social sciencesEducational technology050301 education050109 social psychologyblended learningcomputer.software_genreLearning sciencesvideo lecturesSynchronous learningBlended learningLearning stylesVirtual campuseducational toolsComputingMilieux_COMPUTERSANDEDUCATION0501 psychology and cognitive sciencesvirtual campuslearning styles0503 educationcomputerInstructional simulation
researchProduct

Riconfigurare i territori metroplitani. Forme di urbanizzazione e fenomeni di pressione insediativa sui sistemi di interesse naturale in Sicilia

2018

The consumption of the soil due to urbanization it is a phenomena already for many years under observations, but of which only the scientific environment has noticed the elevated environmental impact progress. From a disciplinary point of view, is possible to identify a line of research focusing on the analysis and identification of new morphologies of urbanization and on the interaction among different settlement patterns coexisting in a specific context. This reading complements with the scientific production about the forms of settlement pressure on environmental systems, producing change and deterioration on natural ecosystems and loss of biodiversity. A necessary reference for this lin…

tale percentuale se considerata per i comuni costieri supera il 75% del territorio urbanizzato. Nel caso dei sistemi naturali i fenomeni di pressione umana pesano su una situazione già critica data da una distribuzione puntuale delle aree protette. Il livello di frammentazione e isolamento di queste aree rischia di peggiorare. In Sicilia l'assenza di strumenti di valutazione ambientale e lo scollamento tra pianificazione urbana e regionale e pianificazione settoriale hanno determinato un inadeguato livello di controllo della pressione umana sui sistemi ambientali. Riguardo a questo quadro generale il presente documento presenta un chiarimento e una riformulazione del rapporto di reciprocità tra ambiente edificato e territorio aperto con l'obiettivo di individuare possibili strategie per gestire i fenomeni di dispersione urbana nel contesto metropolitano obiettivo principale delle politiche territoriali europee e di molte politiche nazionali degli Stati membri.Settore ICAR/20 - Tecnica E Pianificazione UrbanisticaIl consumo del suolo a causa dell'urbanizzazione è un fenomeno già da molti anni sotto osservazione ma di cui solo l'ambiente scientifico ha notato l'elevato impatto ambientale. Da un punto di vista disciplinare è possibile individuare una linea di ricerca incentrata sull'analisi e l'identificazione di nuove morfologie dell'urbanizzazione e sull'interazione tra i diversi modelli insediativi che coesistono in un contesto specifico. Questa lettura si integra con la produzione scientifica sulle forme di pressione insediativa sui sistemi ambientali producendo cambiamento e deterioramento degli ecosistemi naturali e perdita di biodiversità. Un riferimento necessario per questa linea sono gli studi sui processi di frammentazione (lineare concentrato misto) e quelli sulla segregazione degli habitat naturali e seminaturali (protetti o non protetti). Tali riferimenti si combinano con le analisi condotte sul processo di sostituzione dei sistemi naturali con l'ecomosaico artificiale. Lo stato dell'urbanizzazione in Sicilia è interessato dal fenomeno della dispersione urbana che a partire dagli anni Settanta ha contribuito fortemente a plasmare il territorio regionale sia dal punto di vista fisico che funzionale. Tale fenomeno ha interessato principalmente le aree marginali intorno alle aree metropolitane dove i terreni consumati dagli insediamenti a bassa densità abitativa rappresentano il 42% dell'intero territorio urbanizzatoSettore ICAR/21 - Urbanistica
researchProduct

The Conference Reimagined. Postcards, Letters, and Camping Together in Undressed Places

2019

In this paper, five authors account for the rethinking of a conference as a series of postcards, letters, rules and silent moments so that traditional hierarchies of knowledge could be overturned or, at least, sidelined. We recount how the place we convened was enlisted as an actor and the dramas and devices we applied to encounter it. We use this accounting to problematize the conventional practices of goal-oriented meetings and co-authored papers as forms of academic meaning-making. In finding a meeting point where expertise was disorientated and status undressed, we were able to investigate the idea of co-being between human and nonhuman realities as the step social theory needs to take …

tapaamisetkokousmatkailu0507 social and economic geographyhiljaisuuspaikkasosiaalinen vuorovaikutuscampingkonferenssit0502 economics and businessconferencingentangled nonfictiongood lifeSociologyPoint (typography)General Arts and Humanities05 social sciencesMedia studiesGeneral Social SciencesSilenceslow writingHumanities and the ArtsHumaniora och konstsilenceundressed placeshyvä elämä050703 geography050212 sport leisure & tourismTourismSocial theoryDigithum
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

Temperamento materno ed infantile e legame di attaccamento.

2004

temperamento; coppia madre-bambino; attaccamentoattaccamentotemperamentocoppia madre-bambino
researchProduct

Incremento della temperatura lungo la superficie radicolare durante la tecnica dell’onda continua di condensazione

2008

INTRODUZIONE: Le temperature raggiunte degli strumenti portatori di calore, durante la condensazione a caldo della guttaperca, sono molto elevate. Ciò potrebbe rappresentare una fonte di danno iatrogeno a livello delle strutture parodontali sottoposte ad un eccessivo stress termico. SCOPO DEL LAVORO: Valutazione termografica a infrarossi dell’incremento della temperatura lungo la superficie radicolare, durante la tecnica dell’onda continua di condensazione. MATERIALI E METODI: Venti incisivi laterali mascellari, estratti per motivi parodontali, sono stati selezionati e alesati con M-two. In tutti i campioni è stata eseguita un’otturazione canalare mediante coni di guttaperca non standardizz…

temperatura radicolare onda continua termocameraSettore MED/28 - Malattie Odontostomatologiche
researchProduct

A wideband THz Time Domain Spectroscopy system based on pulsed laser: model and experiments

2014

terahertz thz time domain spectroscopy pulsed laserSettore ING-INF/02 - Campi ElettromagneticiSettore ING-INF/01 - Elettronica
researchProduct

Desarrollo y efecto antitumoral de vacunas génicas celulares y silenciamiento génico

2015

La presente tesis utiliza las vacunas antitumorales basadas en células modificadas genéticamente como principal estrategia para intentar lograr una respuesta inmune antitumoral eficaz. La vacunación preventiva con células tumorales modificadas genéticamente ha logrado muy buenos resultados en ratones consiguiendo la inhibición del crecimiento tumoral y la supervivencia final de los mismos. Sin embargo, en la clínica la disponibilidad de ciertas células tumorales es muy baja y su transfección es poco reproducible. Por ello, en esta tesis se plantea como uno de los objetivos principales desarrollar y evaluar el efecto antitumoral de vacunas basadas en complejos celulares formados por células …

terapia génicactla4silenciamiento génicofoxp3melanoma B16oligonucleótidos antisentidoPPRHvacuna antitumorales:CIENCIAS MÉDICAS ::Farmacología ::Evaluación de medicamentos [UNESCO]UNESCO::CIENCIAS MÉDICAS ::Farmacología ::Evaluación de medicamentos
researchProduct

Understanding the White-Emitting CaMoO4 Co-Doped Eu3+, Tb3+, and Tm3+ Phosphor through Experiment and Computation

2019

In this article, the synthesis by means of the spray pyrolysis method, of the CaMoO4 and rare-earth cation (RE3+)-doped CaMoO4:xRE3+ (RE3+ = Eu3+, Tb3+, and Tm3+; and x = 1, 2, and 4% mol) compounds, is presented. The as-synthesized samples were characterized using X-ray diffraction, Rietveld refinement, field emission scanning electron microscopy (FE-SEM), Raman spectroscopy, and photoluminescence (PL) spectroscopy. To complement and rationalize the experimental results, first-principles calculations, at the density functional theory level, have been performed to analyze the band structure and density of states. In addition, a theoretical method based on the calculations of surface energie…

terbium compoundsMaterials scienceTm3+lightingAnalytical chemistryfield emission microscopes02 engineering and technology010402 general chemistry01 natural sciencesSpray pyrolysiseuropium compoundsTb3+White-Emitting CaMoO4Physical and Theoretical Chemistrydensity functional theorycalcium compoundscomputation theoryenamelsPhosphor021001 nanoscience & nanotechnologyred phosphorselectronic structureCo-Doped Eu3+0104 chemical sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsESTRUTURA ELETRÔNICAGeneral Energyphotoluminescence spectroscopylight emissionphosphors0210 nano-technologyspray pyrolysisCo dopedscanning electron microscopy
researchProduct