Search results for "CETA"

showing 10 items of 1865 documents

Association between physiological stress and skin temperature response after a half marathon

2019

OBJECTIVE: The objective of this study was to determine the association between skin temperature response and the physiological stress after a half marathon. APPROACH: Seventeen runners were measured 48 h before, 24 h before, 24 h after and 48 h after completing a half marathon. The measurements on each day of testing included blood markers (creatine kinase [CK] and glutamate oxaloacetate transaminase [GOT]), perception of pain and fatigue (using a visual analogue scale), skin temperature (using infrared thermography), and jump performance (using countermovement jump test). MAIN RESULTS: CK (p     1.0) increased 24 h after the half marathon, whereas jump performance decreased (p   <  0.01 a…

AdultMalemedicine.medical_specialtyTime FactorsPhysiologyVisual analogue scale0206 medical engineeringBiomedical EngineeringBiophysics02 engineering and technologyRunning03 medical and health sciencesBasal (phylogenetics)0302 clinical medicineStress PhysiologicalPhysiology (medical)Internal medicineHumansMedicineBlood markersFatiguePhysiological stressEsportsbiologybusiness.industryFatigaSkin temperaturePain PerceptionGlutamate oxaloacetate transaminase020601 biomedical engineeringbiology.proteinCountermovement jumpCardiologyFemaleCreatine kinaseSkin Temperaturebusiness030217 neurology & neurosurgery
researchProduct

Systemic Treatment with Interferon-α2B: An Effective Method to Prevent Sterility after Bilateral Mumps Orchitis

1991

In men orchitis represents the most common complication of mumps infection and occurs in 5 to 37% of this population. Bilateral manifestation is observed in 16 to 65% of the patients. The most important danger is the risk of testicular atrophy which results in sterility. Four patients with bilateral mumps orchitis received systemic treatment with interferon-alpha 2B (3 x 10(6) IU per day) for 7 days. All acute symptoms of mumps orchitis disappeared within 2 to 4 days of hospitalization. During 6 to 15 months of followup no incidence of testicular atrophy was observed. In 3 of 4 patients pre-treatment examination revealed subfertility (oligoasthenospermia), while 2 to 4 months after interfer…

AdultMalemedicine.medical_specialtyUrologyPopulationAlpha interferonOrchitisInterferon alpha-2TestismedicineHumansProspective StudiesRadionuclide ImagingAdverse effecteducationMumpsInfertility MaleInterferon alfaAcetaminophenUltrasonographyeducation.field_of_studyPalpationTesticular atrophybusiness.industryInterferon-alphamedicine.diseaseRecombinant ProteinsSurgeryConcomitantDrug EvaluationOrchitisComplicationbusinessmedicine.drugJournal of Urology
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Effect of continuous oestradiol-medroxyprogesterone administration on plasma lipids and lipoproteins

1991

Plasma lipids and lipoproteins were measured in 21 post-menopausal women after 4 and 8 months of continuous treatment with an orally administered combination of oestradiol and medroxyprogesterone acetate. The mean concentrations of cholesterol and low-density-lipoprotein (LDL) cholesterol were reduced by 12% (P less than 0.001) and 11% (P less than 0.01), respectively, after 4 months of treatment and by 9% (P less than 0.05) and 12% (P less than 0.05) after 8 months. The mean level of high-density-lipoprotein (HDL) cholesterol showed an initial fall of 5% (P less than 0.05) after 4 months and then increased by 13% (P less than 0.05) after 8 months of treatment. The plasma triglycerides leve…

AdultMedroxyprogesteronemedicine.medical_specialtymedicine.drug_classLipoproteinsMedroxyprogesteronemedicine.medical_treatmentGeneral Biochemistry Genetics and Molecular Biologychemistry.chemical_compoundInternal medicinePlasma lipidsHumansMedicineMedroxyprogesterone acetateClinical significanceProspective StudiesEstradiolProgestogenbusiness.industryCholesterolEstrogen Replacement TherapyObstetrics and GynecologyMiddle AgedLipidsEndocrinologychemistryEstrogenDrug Therapy CombinationFemalelipids (amino acids peptides and proteins)Menopausebusinessmedicine.drugLipoproteinMaturitas
researchProduct

Effect of obesity on disease-free and overall survival in node-positive breast cancer patients in a large French population: A pooled analysis of two…

2014

Abstract Background To examine the association between baseline body mass index (BMI), and disease-free survival (DFS) and overall survival (OS) in a large French early-stage breast cancer population included in the UNICANCER Programme d’Action Concerte Sein-01 (PACS01) and PACS04 phase III randomised trials. Methods After a median follow-up of 5.9 years, this report analyses 4996 patients with node-positive breast cancer, and randomly assigned to adjuvant anthracycline-based chemotherapy combined or not with taxanes. Univariate analyses were used to study the effects of well known prognostic factors and BMI on DFS and OS. BMI was obtained at baseline, before chemotherapy initiation, and ob…

AdultOncologyCancer Researchmedicine.medical_specialtyAntineoplastic Agents HormonalAnthracyclinemedicine.medical_treatmentPopulationBreast NeoplasmsDocetaxelDisease-Free SurvivalBody Mass IndexYoung AdultBreast cancerInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineHumansObesityeducationCyclophosphamideAgedEpirubicinProportional Hazards ModelsChemotherapyeducation.field_of_studyUnivariate analysisbusiness.industryHazard ratioMiddle AgedPrognosismedicine.diseaseSurvival AnalysisObesityTreatment OutcomeOncologyFemaleTaxoidsFluorouracilbusinessBody mass indexEuropean Journal of Cancer
researchProduct

Epirubicin Plus Cyclophosphamide Followed by Docetaxel Versus Epirubicin Plus Docetaxel Followed by Capecitabine As Adjuvant Therapy for Node-Positiv…

2015

Purpose Capecitabine is an active drug in metastatic breast cancer (BC). GEICAM/2003-10 is an adjuvant trial to investigate the integration of capecitabine into a regimen of epirubicin and docetaxel for node-positive early BC. Patients and Methods Patients with operable node-positive BC (T1-3/N1-3) were eligible. After surgery, 1,384 patients were randomly assigned to receive epirubicin plus cyclophosphamide (EC; 90 and 600 mg/m2, respectively, × four cycles), followed by docetaxel (100 mg/m2 × four cycles; EC-T) or epirubicin plus docetaxel (ET; 90 and 75 mg/m2, respectively, × four cycles), followed by capecitabine (1,250 mg/m2 twice a day on days 1 to 14, × four cycles; ET-X); all regime…

AdultOncologyCancer Researchmedicine.medical_specialtymedicine.medical_treatmentBreast NeoplasmsDocetaxelDisease-Free SurvivalDrug Administration ScheduleCapecitabineInternal medicineAntineoplastic Combined Chemotherapy ProtocolsOdds RatiomedicineAdjuvant therapyHumansCyclophosphamideCapecitabineAgedEpirubicinNeoplasm StagingChemotherapybusiness.industryMiddle Agedmedicine.diseaseMetastatic breast cancerSurgeryRegimenTreatment OutcomeOncologyDocetaxelChemotherapy AdjuvantFluorouracilLymphatic MetastasisFemaleTaxoidsFluorouracilLymph NodesbusinessFollow-Up Studiesmedicine.drugEpirubicinJournal of Clinical Oncology
researchProduct

Association Between ABCB1 Genetic Variants and Persistent Chemotherapy-Induced Alopecia in Women With Breast Cancer

2020

Importance Persistent chemotherapy-induced alopecia (pCIA) has been recently described in patients with breast cancer and in its most severe form occurs in up to 10% of these patients. Genetic risk factors associated with pCIA have not been adequately explored. Objective To identify genetic variants associated with pCIA. Design, Setting, and Participants In this genetic association study, 215 women with breast cancer treated with docetaxel-based chemotherapy with a follow-up of 1.5 to 10 years after the end of the treatment were recruited retrospectively through 3 hospital oncology units across Spain between 2005 and 2018. Severe pCIA was defined as lack of scalp hair recovery (Common Termi…

AdultOncologymedicine.medical_specialtyATP Binding Cassette Transporter Subfamily BBiopsyBreast NeoplasmsGenome-wide association studyDocetaxelDermatologyPolymorphism Single Nucleotide030207 dermatology & venereal diseases03 medical and health sciences0302 clinical medicineBreast cancerRisk FactorsInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineHumansGenetic Predisposition to DiseasePromoter Regions GeneticAdverse effectRetrospective StudiesDose-Response Relationship Drugbusiness.industryAge FactorsCase-control studyAlopeciaCommon Terminology Criteria for Adverse EventsRetrospective cohort studyOdds ratioMiddle Agedmedicine.diseaseEnhancer Elements GeneticDocetaxelCase-Control Studies030220 oncology & carcinogenesisFemalebusinessHair FollicleFollow-Up StudiesGenome-Wide Association Studymedicine.drugJAMA Dermatology
researchProduct

Phase 2 Trial of Docetaxel, Gemcitabine, and Oxaliplatin Combination Chemotherapy in Platinum- and Paclitaxel-Pretreated Epithelial Ovarian Cancer

2009

Background: This phase 2 trial was designed to evaluate the efficacy and toxicity of a combination of docetaxel, gemcitabine, and oxaliplatin for platinum- and paclitaxel-pretreated epithelial ovarian cancer. Patients and Methods: Heavily pretreated patients (N = 30; median age, 61 years) received docetaxel, 55 mg/m2; gemcitabine, 500 mg/m2 (day 1); and oxaliplatin, 70 mg/m2 (day 2) biweekly. Twelve patients had platinum-sensitive disease, and 18 patients had platinum-resistant disease. Results: Median follow-up was 18.6 months. No differences in patient characteristics were observed between patients with carboplatinum-sensitive and carboplatinum-resistant disease. In patients with carbopla…

AdultOncologymedicine.medical_specialtyAdolescentOrganoplatinum CompoundsPaclitaxelAnemiaDocetaxelNeutropeniaDeoxycytidineYoung Adultchemistry.chemical_compoundRisk FactorsInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineFallopian Tube NeoplasmsHumansNeoplasm InvasivenessProspective StudiesPeritoneal NeoplasmsAgedNeoplasm StagingOvarian Neoplasmsbusiness.industryObstetrics and GynecologyCombination chemotherapyMiddle AgedPrognosismedicine.diseaseGemcitabineGemcitabineOxaliplatinOxaliplatinTreatment OutcomeOncologyDocetaxelPaclitaxelchemistryFemaleTaxoidsOvarian cancerbusinessmedicine.drugInternational Journal of Gynecological Cancer
researchProduct

A multicenter phase III prospective randomized trial of high-dose epirubicin in combination with cyclophosphamide (EC) versus docetaxel followed by E…

2011

Background: The Gruppo Oncologico Italia Meridionale 9902 trial compared four cycles of high-dose epirubicin plus cyclophosphamide (EC) with four cycles of docetaxel (Taxotere, D) followed by four cycles of EC as adjuvant treatment of node-positive breast cancer. Patients and methods: Patients were randomly assigned to EC (E 120 mg/m 2 , C 600 mg/m 2 , arm A) for four cycles or four cycles of D (100 mg/m 2 ) followed by four cycles of EC (arm B), both regimens every 21 days. Hormone receptor-positive patients were given hormonal therapy for 5 years. Primary end point was 5-year disease-free survival (DFS). Secondary objectives were overall survival (OS) and safety. Results: There were 750 p…

AdultOncologymedicine.medical_specialtyCyclophosphamideBreast NeoplasmsDocetaxelDisease-Free SurvivalBreast cancerInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineHumansProspective StudiesProspective cohort studyCyclophosphamideSurvival analysisEpirubicinGynecologyDose-Response Relationship Drugbusiness.industryCarcinomaHazard ratioOriginal ArticlesHematologyMiddle Agedmedicine.diseaseSurvival AnalysisItalyOncologyDocetaxelLymphatic MetastasisHormonal therapyFemaleTaxoidsLymph NodesbusinessAlgorithmsmedicine.drugEpirubicinAnnals of Oncology
researchProduct

Phase II trial of docetaxel and carboplatin in recurrent platinum-sensitive ovarian, peritoneal and tubal cancer

2007

Abstract Objective. Docetaxel and carboplatin are active in relapsed ovarian, peritoneal and tubal cancer. Recently, two prospective-randomized trials showed an advantage of carboplatin combination regimen with paclitaxel or gemcitabine over carboplatinum alone in platinum-sensitive cases. The question on the most effective combination with the best tolerable side effects still needs to be answered. Methods. Eligible patients had recurrent ovarian, peritoneal or tubal cancer (platinum-free interval >6 months), performance status 0–2 and normal bone marrow, renal and hepatic function. 25 patients (age 18–75 years) were enrolled into this phase II trial. Patients with debulking operation of r…

AdultOncologymedicine.medical_specialtyPopulationDocetaxelGastroenterologyDisease-Free SurvivalCarboplatinchemistry.chemical_compoundInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineFallopian Tube NeoplasmsHumanseducationPeritoneal NeoplasmsAgedOvarian Neoplasmseducation.field_of_studyPerformance statusbusiness.industryObstetrics and GynecologyCancerMiddle AgedDebulkingmedicine.diseaseGemcitabineCarboplatinRegimenOncologyDocetaxelchemistryDrug Resistance NeoplasmFemaleTaxoidsNeoplasm Recurrence Localbusinessmedicine.drugGynecologic Oncology
researchProduct