Search results for "CIT"

showing 10 items of 22474 documents

Cittadinanza e solidarietà oltre il moderno. Sfide e opportunità

2013

solidarietà socialeSettore SPS/07 - Sociologia Generalepolitica socialecittadinanza
researchProduct

A single transient episode of hyperammonemia induces long-lasting alterations in protein kinase A.

2007

A single transient episode of hyperammonemia induces long-lasting alterations in protein kinase A. Am J Physiol Gastrointest Liver Physiol 292: G305-G314,2007; doi:10.1152/ajpgi.00100.2006.-Hepatic encephalopathy in patients with liver disease is associated with poor prognosis. This could be due to the induction by the transient episode of hepatic encephalopathy of long-lasting alterations making patients more susceptible. We show that a single transient episode of hyperammonemia induces long-lasting alterations in signal transduction. The content of the regulatory subunit of the protein kinase dependent on cAMP (PKA-RI) is increased in erythrocytes from cirrhotic patients. This increase is…

soluble guanylate cyclaseAdultLiver CirrhosisMalemedicine.medical_specialtyCirrhosisErythrocytesPhysiologyliver cirrhosisEncephalopathyhepatic encephalopathyBiologyHepatitisLiver diseaseLiver Function TestsReference ValuesPhysiology (medical)Internal medicinemedicineAnimalsHumansHyperammonemiaRats WistarProtein kinase AHepatic encephalopathyAgedHepatologyPortacaval anastomosisMetabolic disorderErythrocyte MembraneGastroenterologyAscitesHyperammonemiaMiddle Agedmedicine.diseaseCyclic AMP-Dependent Protein KinasesRatsDisease Models AnimalEndocrinologyChronic Diseaserat modelsFemaleLiver FailureAmerican journal of physiology. Gastrointestinal and liver physiology
researchProduct

Effect of different processing techniques and presence of antioxidant on the chitosan film performance

2022

In the last two decades, the naturally occurring polysaccharides have gained great attention because of their potential applications in different sectors, for example, from food to biomedical sectors. Chitosan is a cationic polysaccharide with good transparency, and currently, it has been considered also as suitable material for the formulation film and coating in cultural heritage protection. In this work, the chitosan films (Ch), with and without natural antioxidant such as citric acid (CA), are formulated considering two different processing techniques: (i) conventional solvent casting and (ii) compression molding, that is an unconventional method for this polysaccharide, giving the poss…

solvent castingMarketingantioxidantPolymers and PlasticsGeneral Chemical Engineeringchitosan filmsMaterials Chemistrycompression moldingGeneral Chemistrycitric acidJournal of Vinyl and Additive Technology
researchProduct

Morphological and Anatomical Observations of Abnormal Somatic Embryos from Anther Cultures of Citrus reticulata Blanco.

2010

somatic embryogenesis mandarinanatomy in vitro cultureCitrus in vitro culture
researchProduct

Il doping

2013

somministrazione illecito sportivoSettore IUS/01 - Diritto Privatodoping
researchProduct

Global urban environmental change drives adaptation in white clover

2022

Made available in DSpace on 2022-04-28T19:52:06Z (GMT). No. of bitstreams: 0 Previous issue date: 2022-03-18 Urbanization transforms environments in ways that alter biological evolution. We examined whether urban environmental change drives parallel evolution by sampling 110,019 white clover plants from 6169 populations in 160 cities globally. Plants were assayed for a Mendelian antiherbivore defense that also affects tolerance to abiotic stressors. Urban-rural gradients were associated with the evolution of clines in defense in 47% of cities throughout the world. Variation in the strength of clines was explained by environmental changes in drought stress and vegetation cover that varied am…

sopeutuminenRural PopulationvalkoapilaMultidisciplinaryUrbanizationevoluutiokasvillisuusGenes PlantAdaptation PhysiologicalBiological EvolutionSDG 11 - Sustainable Cities and Communities/dk/atira/pure/sustainabledevelopmentgoals/sustainable_cities_and_communitiesevoluutioekologiaHydrogen Cyanide570 Life sciences; biologyTrifoliumkaupungistuminen[SDE.BE]Environmental Sciences/Biodiversity and EcologyCitiesympäristönmuutoksetEcosystemGenome PlantScience (New York, N.Y.)
researchProduct

Tadpole Responses to Environments With Limited Visibility: What We (Don’t) Know and Perspectives for a Sharper Future

2022

Amphibian larvae typically inhabit relatively shallow freshwater environments, and within these boundaries there is considerable diversity in the structure of the habitats exploited by different species. This diversity in habitat structure is usually taken into account in relation to aspects such as locomotion and feeding, and plays a fundamental role in the classification of tadpoles into ecomorphological guilds. However, its impact in shaping the sensory worlds of different species is rarely addressed, including the optical qualities of each of these types of water bodies and the challenges and limitations that they impose on the repertoire of visual abilities available for a typical vert…

sopeutuminenchromophore shiftEcologyympäristötekijätEvolutionsammakkoeläimetaistimetvedenlaatuphenotypic plasticityturbiditylarval visiontoukatsameusphytotelmataQH359-425fenotyyppiEcology Evolution Behavior and SystematicsQH540-549.5Frontiers in Ecology and Evolution
researchProduct

Functional adaptation of sarcolemma to physical stress

2010

sopeutuminenconduction velocityelectromyographyexercise induced damageeccentric exerciselihaksetmuscle fibressolukalvotfyysinen kuormittavuuscell membranes
researchProduct

Intergenerational fitness effects of the early life environment in a wild rodent

2019

The early life environment can have profound, long‐lasting effects on an individual's fitness. For example, early life quality might (a) positively associate with fitness (a silver spoon effect), (b) stimulate a predictive adaptive response (by adjusting the phenotype to the quality of the environment to maximize fitness) or (c) be obscured by subsequent plasticity. Potentially, the effects of the early life environment can persist beyond one generation, though the intergenerational plasticity on fitness traits of a subsequent generation is unclear. To study both intra‐ and intergenerational effects of the early life environment, we exposed a first generation of bank voles to two early life…

sopeutuminenmaternal effectpredictive adaptive responseintergenerational plasticitymetsämyyräympäristötekijätfungipopulaatiodynamiikkasocial environmentsilver spoonsosiaalinen ympäristöearly lifefenotyyppiprotein restrictionpopulation densityasukastiheyskunto
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct