Search results for "CONSTRUCTION"

showing 10 items of 2670 documents

Toward the Development of Load Transfer Efficiency Evaluation of Rigid Pavements by a Rolling Wheel Deflectometer

2020

The jointed rigid pavement is currently evaluated by the Falling weight deflectometer which is rather slow for the testing of the jointed pavements. Continuous nondestructive evaluation of rigid pavements with a rolling wheel deflectometer can be used to measure the load transfer and is investigated. Load transfer is an important indicator of the rigid pavement&rsquo

falling weight deflectometerComputer science0211 other engineering and technologies02 engineering and technologylcsh:TechnologyNondestructive testing021105 building & construction0502 economics and businesssemi-analytical modelGeneral Materials ScienceJoint (geology)Civil and Structural Engineering050210 logistics & transportationrolling wheel deflectometerlcsh:Tbusiness.industry05 social sciencesrigid pavementBuilding and ConstructionStructural engineeringGeotechnical Engineering and Engineering GeologyComputer Science ApplicationsContinuous dataFalling weight deflectometerTransfer efficiencyjointsload transferDevelopment (differential geometry)businessInfrastructures
researchProduct

Enquête sur l’atelier : histoire, fonctions, transformations

2014

Une stylisation de l’histoire de l’atelier d’artiste fait dependre ses fonctions du degre d’individualisation du travail createur, des innovations esthetiques et de l’economie de la production artistique. La periodisation qui suit fournit une trame sommaire. Indistinction entre art et artisanat d’abord : les ateliers sont situes dans les monasteres, dans les demeures des mecenes de la cour ou se confondent avec le domicile ou avec la boutique d’artisan en ville. Variabilite croissante des emp...

familleconstructionHistoryworkshopfamilyVisual Arts and Performing Artsfemmeart market[SHS]Humanities and Social SciencesatelierworkcréationcreationprofessionComputingMilieux_MISCELLANEOUSsociabilitéeducationchantiermétierformation[SHS.ART]Humanities and Social Sciences/Art and art historymarchépeintureapprentissagepaintingsociabilitytravail[SHS.ART] Humanities and Social Sciences/Art and art historycorporationwomen
researchProduct

Exploring identity construction in bilingual families

2017

Tämän pro gradu-tutkielman tarkoituksena on tarkastella kahden kaksikielisen perheen jäsenten identiteetin rakentumista. Vaikka kaksikielisyyttä perheissä on tutkittu laajalti, identiteetin rakentumisen näkökulmasta tutkimuksia on suhteellisen vähän. Tutkimus on luonteeltaan laadullinen ja tavoitteena oli selvittää miten perheenjäsenet kuvaavat identiteettiään ja identifioituvat kieliinsä sekä millaisia identiteettejä he rakentavat itselleen. Identiteettiin liittyen, tukielma halusi myös vastata kysymyksiin kielen käytöstä sekä tunteiden ilmaisemisesta. Tutkielma myös tarkastelee mahdollisia eroja ja yhtäläisyyksiä identiteettien välillä sukupolvien sekä sisarusten kesken. Lähtökohtana tutk…

familykaksikielisyysidentiteettiperhebilingualismidentity constructionidentity
researchProduct

Modeling the influence of potassium content and heating rate on biomass pyrolysis

2017

This study presents a combined kinetic and particle model that describes the effect of potassium and heating rate during the fast pyrolysis of woody and herbaceous biomass. The model calculates the mass loss rate, over a wide range of operating conditions relevant to suspension firing. The shrinking particle model considers internal and external heat transfer limitations and incorporates catalytic effects of potassium on the product yields. Modeling parameters were tuned with experimentally determined char yields at high heating rates (>200 K s−1) using a wire mesh reactor, a single particle burner, and a drop tube reactor. The experimental data demonstrated that heating rate and potassium …

fast pyrolysisParticle modelheating rate020209 energyPotassiumchemistry.chemical_elementBiomass02 engineering and technologyManagement Monitoring Policy and LawEnergy engineeringMetaplast0202 electrical engineering electronic engineering information engineeringmetaplastWaste managementpotassiumMechanical EngineeringHerbaceous biomassBuilding and ConstructionHeating ratePulp and paper industryKineticsGeneral EnergychemistrykineticsHeat transferPotassiumParticle sizePyrolysisFast pyrolysis
researchProduct

Exploiting Data Analytics and Deep Learning Systems to Support Pavement Maintenance Decisions

2021

Road networks are critical infrastructures within any region and it is imperative to maintain their conditions for safe and effective movement of goods and services. Road Management, therefore, plays a key role to ensure consistent efficient operation. However, significant resources are required to perform necessary maintenance activities to achieve and maintain high levels of service. Pavement maintenance can typically be very expensive and decisions are needed concerning planning and prioritizing interventions. Data are key towards enabling adequate maintenance planning but in many instances, there is limited available information especially in small or under-resourced urban road authorit…

feature importancepavement management systemComputer science0211 other engineering and technologiespavement maintenance decision02 engineering and technologypavement management systemslcsh:Technologylcsh:ChemistryGoods and services021105 building & construction0502 economics and business11. SustainabilitySettore ICAR/04 - Strade Ferrovie Ed AeroportiGeneral Materials Scienceroad asset databasesInstrumentationlcsh:QH301-705.5Fluid Flow and Transfer Processes050210 logistics & transportationbusiness.industryLevel of servicelcsh:TProcess Chemistry and TechnologyDeep learning05 social sciencesGeneral EngineeringPavement managementdeep learningTimelinedata mininglcsh:QC1-999Computer Science Applicationsroad asset databaseWorkflowRisk analysis (engineering)lcsh:Biology (General)lcsh:QD1-999lcsh:TA1-2040Key (cryptography)Settore ICAR/17 - DisegnoArtificial intelligencepavement maintenance decisionsbusinesslcsh:Engineering (General). Civil engineering (General)Predictive modellinglcsh:PhysicsApplied Sciences
researchProduct

Promoting the Flexibility of Thermal Prosumers Equipped with Heat Pumps to Support Power Grid Management

2023

The increasing share of renewable energy sources in energy systems will lead to unpredictable moments of surplus/deficit in energy production. To address this issue, users with heat pumps can provide support to power grid operators through flexible unit operation achieved via Demand Response programs. For buildings connected to low-temperature heating networks with ensured third-party access, further room for flexibility can be explored by investigating the production of surplus heat that can be sold to the network. A key aspect lies in the identification of the energy pricing options that could encourage such flexible operation of a heat pump by “thermal prosumers”. To this aim…

flexibilityheat pumpdistrict heating network; renewable energy; heat pump; prosumer; flexibility; heat pricingheat pricingprosumerRenewable Energy Sustainability and the EnvironmentGeography Planning and DevelopmentSettore ING-IND/10 - Fisica Tecnica Industrialedistrict heating networkBuilding and ConstructionManagement Monitoring Policy and Lawrenewable energySustainability
researchProduct

Emergency free flaps for the reconstruction of open injuries of the upper limb: A review

2004

Debridement of all necrotic and contaminated tissues followed by immediate soft: tissue coverage in order to obtain primary healing is nowadays the standard approach to all open injuries of the extremities. In 1977 Foucher et al. introduced for the first time the concept of immediate treatment at one time of all injured tissues in complex traumas of the upper limb. The final goal of this therapeutic approach is early postoperative mobilization of the hand and of the whole upper extremity. Any delay in treatment will lead to higher risk of infection, to granulation tissue formation and extended fibrosis, reduced flap survival rate, longer hospital stay, late rehabilitation and eventually to …

free-flapearly reconstructiondebridement
researchProduct

Hybrid Propulsion Efficiency Increment through Exhaust Energy Recovery—Part 2: Numerical Simulation Results

2023

The efficiency of hybrid electric vehicles may be substantially increased if the energy of exhaust gases, which do not complete the expansion inside the cylinder of the internal combustion engine, is efficiently recovered using a properly designed turbo-generator and employed for vehicle propulsion. Previous studies, carried out by the same authors of this work, showed a potential hybrid vehicle fuel efficiency increment up to 15% employing a 20 kW turbine on a 100 HP-rated power thermal unit. The innovative thermal unit proposed here is composed of a supercharged engine endowed with a properly designed turbo-generator, which comprises two fundamental elements: an exhaust gas turbine expres…

gas turbineControl and OptimizationSettore ING-IND/08 - Macchine A FluidoRenewable Energy Sustainability and the Environmentradial turbineEnergy Engineering and Power TechnologyBuilding and Constructionhybrid electric vehicles (HEVs)Electrical and Electronic Engineeringturbo-generatorEngineering (miscellaneous)Energy (miscellaneous)turbine geometry
researchProduct

Powstania zapamiętane. Opowieści wspomnieniowe na temat powstań śląskich funkcjonujące w obiegu społecznym

2021

Przedmiotem artykułu jest sposób funkcjonowania w obiegu społecznym pamięci o powstaniach śląskich. Ważną rolę pełnią tu opowieści byłych powstańców, które ze względu na dystans czasowy podlegają folkloryzacji i fabularyzacji (do narracji włączane są wydarzenia późniejsze, związane na przykład z przeżyciami z czasów II wojny światowej). Wspomnienia drukowane są w antologiach, zrealizowano również projekt Filmowa encyklopedia powstań śląskich, gdzie o życiu powstańców opowiadają ich potomkowie. Wiedza o powstaniach popularyzowana jest także przez organizowanie konkursów dla młodzieży, przedstawianie rekonstrukcji historycznych, spotkania i wystawy. Autorka zauważa, że we współczesnych sposob…

gawędziarstwo konkursowehistorical reconstructioncontest storytellingcollective memorypamięć zbiorowarekonstrukcja historycznapowstania śląskiethe Silesian UprisingsKsiążnica Śląska
researchProduct

Predicative Gerunds in Spanish and Catalan

2014

In this article I discuss an instance of microvariation in Catalan, which regards the distribution of predicative gerunds. It is proposed that the differences depend on restrictions on the movement of the verb: the more it is restricted, the less contexts will allow the use of gerunds. A crucial argument for this analysis comes from the comparison with Cinque's (1999) hierarchy of functional heads: in all Catalan varieties gerunds can express the aspectual values which are lower in the hierarchy. Conversely, only the varieties where gerunds are most widespread (Central Catalan) allow them to express also the higher aspectual values. In the last part of the article, I argue that there is an …

generative grammarRomance SyntaxaspectSpanishSettore L-LIN/07 - Lingua E Traduzione - Lingua SpagnolaCatalangerundpredicative constructionSettore L-LIN/01 - Glottologia E Linguistica
researchProduct