Search results for "Computer"

showing 10 items of 30657 documents

Experimental Investigation of Efficiency Map for an Inverter-Fed Surface-Mount Permanent Magnet Synchronous Motor

2019

Losses in inverter-fed permanent magnet motors are underestimated by using analytical or numerical approach since additional losses due to extra harmonics of the frequency converter are normally skipped. Further, losses in switches and passive components of the converter and the effect of switching frequencies cannot be numerically taken into consideration. Loss-minimizing control and proper efficiency analysis of inverter-fed permanent magnet motors cannot be achieved if an efficiency map is built based on a numerical investigation of the motors alone. This works first reviews losses in a surface-mount permanent magnet synchronous motor (SPMSM) and frequency converters. The efficiency map …

010302 applied physicsPermanent magnet synchronous motorComputer science020208 electrical & electronic engineeringSwitching frequency02 engineering and technologyConverters01 natural sciencesControl theoryModulationHarmonicsvisual_artMagnet0103 physical sciencesElectronic component0202 electrical engineering electronic engineering information engineeringvisual_art.visual_art_mediumInverter2019 8th International Conference on Renewable Energy Research and Applications (ICRERA)
researchProduct

On asymmetric periodic solutions in relay feedback systems

2021

Abstract Asymmetric self-excited periodic motions or periodic solutions which are produced by relay feedback systems that have symmetric characteristics are studied in the paper. Two different mechanisms of producing an asymmetric oscillation by a system with symmetric properties are noted and analyzed by the locus of a perturbed relay system (LPRS) method. Bifurcation between the ability to excite symmetric and asymmetric oscillation with variation of system parameters is analyzed. An algorithm of finding asymmetric solutions is proposed.

010302 applied physicsPhysics0209 industrial biotechnologyComputer Networks and CommunicationsApplied MathematicsMathematical analysis02 engineering and technology01 natural scienceslaw.invention020901 industrial engineering & automationControl and Systems EngineeringRelaylaw0103 physical sciencesSignal ProcessingSystem parametersOscillation (cell signaling)Locus (mathematics)BifurcationJournal of the Franklin Institute
researchProduct

The Acoustic Wave Behavior Within the PEA Cell for Space Charge Measurement

2018

In order to evaluate the acoustic wave behavior within the Pulsed Electro Acoustic (PEA) cell, a simulation model has been developed in this work. The model, implemented in Matlab environment, is based on the analogy between acoustic and electrical quantities. Therefore, it was possible to model the PEA cell as cascade connected lossy transmission lines. The model has been validated theoretically by making a comparison with a simulation result found in literature. The experimental validation has also been made by using the PEA cell of the LEPRE high voltage lab. In addition, four graphs have been realized. Two of them can be used to establish in easy and fast way to obtain the minimum groun…

010302 applied physicsPhysics021103 operations researchPEA methodAcousticsElectronic Optical and Magnetic Material0211 other engineering and technologiesPEA modelHigh voltage02 engineering and technologyAcoustic wave01 natural sciencesSignalSpace chargeSettore ING-IND/31 - ElettrotecnicaCascade0103 physical sciencesElectrodeReflection phenomenonReflection (physics)Electrical and Electronic EngineeringMATLABcomputercomputer.programming_language
researchProduct

Identification of parameters and harmonic losses of a deep-bar induction motor

2017

High frequency harmonics from a frequency converter causes additional losses in a deep-bar induction motor. The harmonics have their own amplitude and phase with respect to the fundamental signal, but the harmonic loss is only dependent on the amplitude of harmonics. A deep-bar induction motor can be modelled by a triple-cage circuit to take skin effect into account. The triple cage circuit having many parameters could be estimated from a small-signal model of the machine by using Differential Evolution. The correctly estimated parameters make the triple-cage circuit valid in a wide range of frequencies. However, the triple-cage circuit is very complicated which makes it difficult to model …

010302 applied physicsPhysicsFrequency multiplier020208 electrical & electronic engineering02 engineering and technologyLC circuit01 natural sciencesHarmonic analysisComputer Science::Hardware ArchitectureComputer Science::Emerging TechnologiesControl theoryHarmonics0103 physical sciences0202 electrical engineering electronic engineering information engineeringHarmonicEquivalent circuitInduction motorLinear circuit2017 Seventh International Conference on Information Science and Technology (ICIST)
researchProduct

Mass calibration of the energy axis in ToF- E elastic recoil detection analysis

2016

We report on procedures that we have developed to mass-calibrate the energy axis of ToF-E histograms in elastic recoil detection analysis. The obtained calibration parameters allow one to transform the ToF-E histogram into a calibrated ToF-M histogram.

010302 applied physicsPhysicsNuclear and High Energy Physicsta114Physics::Instrumentation and DetectorsPhysics::Medical PhysicsAstrophysics::Instrumentation and Methods for AstrophysicsERD02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesNuclear physicsElastic recoil detectionComputer Science::Computer Vision and Pattern RecognitionHistogramelastic recoil detection analysis0103 physical sciencesCalibrationmass calibrationToF-ENuclear Experiment0210 nano-technologyInstrumentationEnergy (signal processing)Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Erratum: “Concentric transmon qubit featuring fast tunability and an anisotropic magnetic dipole moment” [Appl. Phys. Lett. 108, 032601 (2016)]

2018

010302 applied physicsPhysicsPhysics and Astronomy (miscellaneous)Magnetic momentCondensed matter physics02 engineering and technologyTransmonConcentric021001 nanoscience & nanotechnology01 natural sciencesMagnetic anisotropyQubit0103 physical sciences0210 nano-technologyAnisotropyQuantum computerApplied Physics Letters
researchProduct

Fundamentals on the Molecular Mechanism of Action of Antimicrobial Peptides

2019

Abstract Antimicrobial peptides (AMPs) are produced by several organisms as their first line of defense. Constituted by amino acids, they may present different mechanisms of action. The antimicrobial activity can be used by the peptide-producing organism itself, as innate immune strategy, or in the industry, applying as natural source preservatives. Understanding the possibilities of the operation of these compounds is a prerequisite for the development of effective uses, as well as for the establishment of combinations, which can even expand their applications considering the possibilities of genetic manipulations. Thus, the objective of this article is to review the basic principles of AM…

010302 applied physicsPhysiological functionMaterials scienceInnate immune systemComputer scienceFirst lineAntimicrobial peptides02 engineering and technology021001 nanoscience & nanotechnologyAntimicrobial01 natural sciencesAction (philosophy)0103 physical sciencesNatural sourceMolecular mechanismGeneral Materials ScienceBiochemical engineering0210 nano-technologyOrganismSSRN Electronic Journal
researchProduct

Online Management of Hybrid DRAM-NVMM Memory for HPC

2019

Non-volatile main memories (NVMMs) offer a comparable performance to DRAM, while requiring lower static power consumption and enabling higher densities. NVMM therefore can provide opportunities for improving both energy efficiency and costs of main memory. Previous hybrid main memory management approaches for HPC either do not consider the unique characteristics of NVMMs, depend on high profiling costs, or need source code modifications. In this paper, we investigate HPC applications' behaviors in the presence of NVMM as part of the main memory. By performing a comprehensive study of HPC applications and based on several key observations, we propose an online hybrid memory architecture for …

010302 applied physicsProfiling (computer programming)Source codebusiness.industryComputer sciencemedia_common.quotation_subject02 engineering and technology01 natural sciences020202 computer hardware & architectureNon-volatile memoryMemory managementEmbedded system0103 physical sciencesMemory architecture0202 electrical engineering electronic engineering information engineeringKey (cryptography)businessDrammedia_common2019 IEEE 26th International Conference on High Performance Computing, Data, and Analytics (HiPC)
researchProduct

An Energy Saving Mechanism Based on Vacation Queuing Theory in Data Center Networks

2018

To satisfy the growing need for computing resources, data centers consume a huge amount of power which raises serious concerns regarding the scale of the energy consumption and wastage. One of the important reasons for such energy wastage relates to the redundancies. Redundancies are defined as the backup routing paths and unneeded active ports implemented for the sake of load balancing and fault tolerance. The energy loss may also be caused by the random nature of incoming packets forcing nodes to stay powered on all the times to await for incoming tasks. This paper proposes a re-architecturing of network devices to address energy wastage issue by consolidating the traffic arriving from di…

010302 applied physicsQueueing theorybusiness.industryComputer scienceNetwork packet020206 networking & telecommunicationsFault tolerance02 engineering and technologyEnergy consumptionData center networksLoad balancing (computing)01 natural sciencesNetworking hardwareBackupPower consumption0103 physical sciencesVacation queuing theory0202 electrical engineering electronic engineering information engineeringData centerbusinessComputer network
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct