Search results for "Critical infrastructure"

showing 10 items of 20 documents

Effects of cyber domain in crisis management

2019

There is fundamental need in EU-level to develop common alarm procedures and emergency response models with preventive functions which work well from local to national level and from national to international level. European Public Protection and Disaster Relief (PPDR) services such as law enforcement, firefighting, emergency medical and disaster recovery services have recognized that lack of interoperability of technical systems limits cooperation between the PPDR authorities. Also, the military (MIL) and critical infrastructure protection (CIP) faces similar challenges. Recent major accidents have indicated that lack of human resources affects to disaster recovery. PPDR-actors cannot star…

PPDRpelastustoimiemergency responsecritical infrastructure protectionpelastustoimintainfrastruktuurittoimintamallitkyberturvallisuushätätilanteetcontinuity managementcyber-physical threats
researchProduct

Group model building: a collaborative modelling methodology applied to critical infrastructure protection

2012

Large crises management, affecting CIs needs multidisciplinary knowledge including technical, economical, social, political, legal and managerial knowledge. Being these crises international a huge variety of agents is involved in their response. This situation concludes in a set of stakeholders who only have fragmented knowledge. In the presence of dispersed and incomplete knowledge, and of fragmented and disrupted crisis management, the collaborative approach group model building (GMB), where modelling experts unify fragmented, tacit knowledge from domain experts, is a valuable option. However, GMB has been little used in CIP. We have done so in the context a European project on crisis man…

PoliticsEngineeringKnowledge managementTacit knowledgebusiness.industryMultidisciplinary approachCritical infrastructure protectionContext (language use)Crisis managementbusinessSystem dynamicsVariety (cybernetics)International Journal of Organisational Design and Engineering
researchProduct

Cyber Situational Awareness in Critical Infrastructure Organizations

2021

The capability related to cybersecurity plays an ever-growing role on overall national security and securing the functions vital to society. The national cyber capability is mainly composed by resilience of companies running critical infrastructures and their cyber situational awareness (CSA). According to a common view, components of critical infrastructures become more complex and interdependent on each other and, as a consequence, ramifications of incidents multiply. In practice, the actions relate to developing better CSA and understanding of a critical infrastructure organization. The aim is to prepare for incidents and their management in a whole-of-society approach. The arrangement i…

Process managementNational securitySituation awarenessOperating modelcybersecurityProcess (engineering)business.industryturvallisuusympäristömedia_common.quotation_subjectInformation sharingtilannekuvaCritical infrastructureInterdependencesituational awarenesscritical infrastructureinformation sharingvital societal functionsBusinessinfrastruktuuritkansallinen turvallisuusResilience (network)kyberturvallisuusmedia_common
researchProduct

Cyber-Security in Digital Metering Value Chain for Mountain Landslide Warning

2021

The Norwegian Water Resources and Energy Directorate (NVE) are initiating a digitalization process that involves the use of a digital metering value chain and cloud computing. The main objective of this study is to investigate how NVE can ensure cyber-security in digital meters and the cloubased metering value chain for mountain landslide warning. The study is based on a qualitative approach including methods like document analysis and semi structured interviews used as input to a risk analysis based on the ISO 31000 standard. The risk analysis covered three different scenarios from NVE. Those three scenarios were internal, external Norwegian, and transnational value chains for metering lan…

Risk analysisRisk analysis (engineering)business.industryComputer scienceISO 31000LandslideMetering modeCloud computingRisk assessmentbusinessRisk managementCritical infrastructure
researchProduct

Cyber Situational Awareness in Critical Infrastructure Protection

2020

The European Union promotes collaboration between authorities and the private sector, and the providers of the most critical services to society face security related obligations. In this paper, critical infrastructure is seen as a system of systems that can be subject to cyber-attacks and other disturbances. Situational awareness (SA) enhances preparations for and decision-making during assessed and unforeseen disruptive incidents, and promoting Cyber effective situational awareness (CSA) requires information sharing between the different interest groups. This research is constructive in nature, where innovative constructions developed as solutions for domain-specific real world problem…

System of systemsSituation awarenessbusiness.industryInternet privacyCritical infrastructure protectionOcean EngineeringCritical infrastructureOODA loopmedia_common.cataloged_instanceBusinessEuropean unionSituational ethicsResilience (network)media_commonAnnals of Disaster Risk Sciences
researchProduct

Towards a resilience management guideline — Cities as a starting point for societal resilience

2019

Unexpected crises and risks affect the urban population. Critical infrastructure dependency, climate change and social dynamics have captured the attention of city decision makers across different disciplines, sectors, and scales. Addressing these challenges mandates an increase in resilience. This article presents the development of the novel European Resilience Management Guideline (ERMG) developed by the European H2020 Smart Mature Resilience (SMR) project. It encompasses five supporting tools for city resilience. The purpose of this article is threefold. First, it describes the extensive co-creation methods used to establish, validate and test the five ERMG tools as collaborations among…

education.field_of_studyProcess managementOperationalizationRenewable Energy Sustainability and the Environmentbusiness.industryGeography Planning and DevelopmentPopulation0211 other engineering and technologiesTransportation02 engineering and technology010501 environmental sciences01 natural sciencesCritical infrastructureSocial dynamicsHD61Strategic management021108 energyBusinessResilience (network)educationUrban resilienceRisk management0105 earth and related environmental sciencesCivil and Structural EngineeringSustainable Cities and Society
researchProduct

Terveydenhuolto ja kyberuhkat

2019

Kyberturvallisuusstrategian vision mukaan Suomen tulee kyetä suojaamaan elintärkeät toimintonsa kyberuhkaa vastaan kaikissa tilanteissa. Terveydenhuolto on yksi elintärkeistä toiminnoista. Terveystoimiala on kyberhyökkäysten top-5-listalla ensimmäisenä. Hyökkäysten keskeisin motivaatio on potilastietojen arvo pimeillä markkinoilla. Vuonna 2015 varastettiin yli satamiljoonaa potilastietoa, jotka sisältävät rikollisille arvokkaita tietoja, kuten luottokorttinumeroita, työnantajatietoja ja sairaushistoriatietoja. Tässä artikkelissa kuvataan terveydenhuoltoon liittyviä kyberuhkia, kyberhaavoittuvuuksia ja toteutuneita kyberhyökkäyksiä kybermaailman eri ulottuvuudet kattaen. Tarkastelussa käytet…

health care [http://www.yso.fi/onto/yso/p2641]kyberturvallisuus [http://www.yso.fi/onto/yso/p26189]cyber threatcritical infrastructurekyberuhkaterveydenhuoltoterveydenhoitocyber security [http://www.yso.fi/onto/yso/p26189]kyberturvallisuusMuut artikkelit / Other articleskriittinen infrastruktuuriterveydenhuolto [http://www.yso.fi/onto/yso/p2658]Finnish Journal of eHealth and eWelfare
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Health care and cyber threats

2019

ta113critical infrastructurecyber threatkyberuhkaterveydenhuoltocyber securitykyberturvallisuushealth carekriittinen infrastruktuuriFinnish Journal of eHealth and eWelfare
researchProduct

Emergency Response Model as a part of the Smart Society

2021

Centralized hybrid emergency model with predictive emergency response functions is necessary when the purpose is to protect the critical infrastructure (CI). A shared common operational picture among Public Protection and Disaster Relief (PPDR) authorities means that a real-time communication link from the local level to the state-level exists. If a cyberattack would interrupt electricity transmission, telecommunication networks will discontinue operating. Cyberattack becomes physical in the urban and maritime area if an intrusion has not been detected. Hybrid threats require hybrid responses. The purpose of this qualitative research was to find out technological-related fundamental risks …

turvallisuuspalveluttekoälyartificial intelligenceGeneralLiterature_MISCELLANEOUScritical infrastructure protection cyber ecosystem emergency response public protection and disaster relief artificial intelligenceemergency responsecritical infrastructure protectioncyber ecosystempublic protection and disaster relieftoimintavalmius (organisaatiot)infrastruktuuritviranomaisettietoverkotkyberturvallisuusverkkohyökkäyksetvalmiussuunnittelu
researchProduct