Search results for "D.N.A."

showing 10 items of 6568 documents

A comparison between two feature selection algorithms

2017

This article provides a comparison of two feature selection algorithms, Information Gain Thresholding and Koller and Sahami's algorithm in the context of text document classification on the Reuters Corpus Volume 1 dataset. The algorithms were evaluated by testing the performance of classifiers trained on the features they select from a given dataset. Results show that Koller and Sahami's algorithm consistently outperforms Information Gain Thresholding by capturing interactions between features and avoiding redundancy among features, although it achieves its gains through increased complexity and longer running time.

symbols.namesakeTruncation selectionRedundancy (information theory)Computer scienceFeature extractionsymbolsMarkov processFeature selectionAlgorithm designThresholdingAlgorithmRunning time2017 21st International Conference on System Theory, Control and Computing (ICSTCC)
researchProduct

Computing variations of entropy and redundancy under nonlinear mappings not preserving the signal dimension: quantifying the efficiency of V1 cortex

2021

In computational neuroscience, the Efficient Coding Hypothesis argues that the neural organization comes from the optimization of information-theoretic goals [Barlow Proc.Nat.Phys.Lab.59]. A way to confirm this requires the analysis of the statistical performance of biological systems that have not been statistically optimized [Renart et al. Science10, Malo&Laparra Neur.Comp.10, Foster JOSA18, Gomez-Villa&Malo J.Neurophysiol.19]. However, when analyzing the information-theoretic performance, cortical magnification in the retina-cortex pathway poses a theoretical problem. Cortical magnification stands for the increase the signal dimensionality [Cowey&Rolls Exp. Brain Res.74]. Conventional mo…

symbols.namesakeWaveletRedundancy (information theory)Dimension (vector space)Computer scienceJacobian matrix and determinantsymbolsEntropy (information theory)Total correlationEfficient coding hypothesisAlgorithmCurse of dimensionalityProceedings of Entropy 2021: The Scientific Tool of the 21st Century
researchProduct

Uncertainty analysis and symmetry restoration in nuclear self-consistent methods

2015

This thesis contains two articles, in the following denoted by I and II, and an introduction to them. In Chapter 1, I present the theoretical models of nuclear structure. In Chapter 2, I introduce the basic ideas about the density functional theory (DFT) and self-consistent mean-field (SCMF) calculations. In Chapter 3, I give the formulae for the uncertainty propagation, which is the error analysis method used in article I. As a proper tool to survey the predictive power of theoretical models, the error analysis now has become more and more widely used. By analyzing the propagation of uncertainties, one tries to find out the e ectiveness of the calculation with a given parameter set obtaine…

symmetriaydinrakenneenergiatiheysfunktionaalitnuclear density functional theorytiheysfunktionaaliteorianuclear structurepropagation of uncertaintyenergy-density-functionalssymmetry restorationmatemaattiset mallitydinfysiikkavirheanalyysi
researchProduct

Synthesis of new hybrid 1,4-thiazinyl-1,2,3-dithiazolyl radicals via Smiles rearrangement

2017

The condensation reaction of 2-aminobenzenethiols and 3-aminopyrazinethiols with 2-amino-6-fluoro-N-methylpyridinium triflate afforded thioether derivatives that were found to undergo Smiles rearrangement and cyclocondensation with sulphur monochloride to yield new hybrid 1,4-thiazine-1,2,3-dithiazolylium cations. The synthesized cations were readily reduced to the corresponding stable neutral radicals with spin densities delocalized over both 1,4-thiazinyl and 1,2,3-dithiazolyl moieties. peerReviewed

synthesis010405 organic chemistryChemistryRadical12010402 general chemistryPhotochemistryCondensation reaction01 natural sciences0104 chemical sciencesInorganic Chemistrychemistry.chemical_compoundDelocalized electron14-thiazinyl-123-dithiazolyl radicalsThioether4-thiazinyl-1Smiles rearrangementYield (chemistry)Polymer chemistrysynteesiSmiles rearrangementTrifluoromethanesulfonateta1163-dithiazolyl radicalsDalton Transactions
researchProduct

Organocatalytic Oxa-Michael/Michael/Michael/Aldol Condensation Quadruple Domino Sequence : Asymmetric Synthesis of Tricyclic Chromanes

2018

An efficient and highly stereoselective one-pot, four-component synthesis of functionalized tricyclic chromanes has been achieved through an organocatalyzed quadruple domino reaction. The reaction sequence involves an oxa-Michael/Michael/Michael/aldol condensation between alcohols, 2 equiv of acrolein, and nitrochromenes to generate the pharmaceutically important tricyclic chromanes bearing three contiguous stereogenic centers including a chiral tetrasubstituted carbon center in good domino yields (30–70%) and excellent diastereo- and enantioselectivities (>20:1 dr and >99% ee). peerReviewed

synthesisalkoholit (yhdisteet)natural productsStereochemistryasymmetric synthesisluonnontuotteet010402 general chemistry01 natural sciencesBiochemistryDominoStereocenterchemistry.chemical_compoundCascade reactionsynteesiPhysical and Theoretical Chemistryta116chemistry.chemical_classification010405 organic chemistryOrganic ChemistryAcroleindomino reactionsEnantioselective synthesistricyclic chromanes0104 chemical scienceschemistryalcohols (organic compounds)asymmetriaAldol condensationStereoselectivityasymmetryTricyclic
researchProduct

Nuorten näkemys Euroopasta nyt ja lähitulevaisuudessa : kansainvälisen ICCS 2016 -tutkimuksen Eurooppa-arviointi

2017

syrjintäkansalaisoikeudetasenteettiedonsaantikansalaisvelvollisuudetkansalaisuuskansalaisyhteiskuntayhteiskunnalliset vaikuttajatnuoretmaahanmuuttoidentiteettipoliittisuustulevaisuusEurooppaarviointikuluttajuusosallistuminen
researchProduct

Gingivitis

2014

Gingival inflammation is caused by bacterial plaque (dental biofilm) that accumulates daily on the teeth. Results in redness, slight swelling, or "puffiness" of the gums and bleeding on tooth brushing. Treatment involves thorough professional tooth cleaning and effective daily removal of dental plaque by tooth brushing and cleaning between the teeth. Necrotizing ulcerative gingivitis (NUG) is a more serious condition that is mainly found in developing countries associated with people with severe malnutrition or HIV/AIDS with low CD4 T-cell counts.

systemic diseasesdental plaqueSettore MED/28 - Malattie OdontostomatologicheSettore MED/50 - Scienze Tecniche Mediche Applicategingiviti
researchProduct

Serum cytokines in elite skiing athletes associate with triglyceride metabolism

2022

sytokiinitaineenvaihduntahiihtäjäthuippu-urheilijat
researchProduct

Portaalidosimetrian käyttö sädehoitokiihdyttimen laadunvarmistuksessa

2009

sädehoitolaadunvarmistusilmaisimetdosimetrithiukkaskiihdyttimetportaalidosimetria
researchProduct

Ionisaatiokammiomatriisin käyttö intensiteettimuokatun sädehoidon laadunvarmistuksessa

2008

sädehoitolaadunvarmistuslääketieteellinen fysiikkaIMRT
researchProduct