Search results for "DETECTION"

showing 10 items of 2543 documents

High yield neutron generator based on a high-current gasdynamic electron cyclotron resonance ion source

2015

In present paper, an approach for high yield compact D-D neutron generator based on a high current gasdynamic electron cyclotron resonance ion source is suggested. Results on dense pulsed deuteron beam production with current up to 500 mA and current density up to 750 mA/cm2 are demonstrated. Neutron yield from D2O and TiD2 targets was measured in case of its bombardment by pulsed 300 mA Dþ beam with 45 keV energy. Neutron yield density at target surface of 109 s 1 cm2 was detected with a system of two 3 He proportional counters. Estimations based on obtained experimental results show that neutron yield from a high quality TiD2 target bombarded by Dþ beam demonstrated in present work accele…

ta114ChemistryAstrophysics::High Energy Astrophysical PhenomenaNuclear TheoryGeneral Physics and AstronomyNeutron scatteringelectron cyclotron resonance ion sourceNeutron temperatureNuclear physicsNeutron captureneutron generatorsneutron yieldNeutron generatorNeutron cross sectionNeutron detectionNeutron sourceNeutronNuclear ExperimentJournal of Applied Physics
researchProduct

The hyperspectral and smartphone technology in CBRNE countermeasures and defence

2016

Caused by industrial and military use as well as other sources of chemical, biological, radiological, nuclear and high-yield explosive (CBRNE) materials, the global threat of weapons of mass destruction (WMDs) remains in spite of such weapons being internationally prohibited. With these materials, industrial and transportation accidents are likely in all countries and can also be triggered by natural disasters, such as in Fukushima in 2011. In addition, governments cannot fully control the manufacturing and usage of WMDs, as extreme terrorists have access to as well as the knowledge and motivation to use such materials. Due to multiple large-scale risks, the countering of CBRNE threats requ…

tekninen rikostutkintaemergency alertinghälytysjärjestelmätspektrikuvaussuuronnettomuudetmiehittämättömät ilma-alukseträjähdysaineethälytyksetkriisiviestintäälypuhelimetpublic warningCBRNE defencehyperspectral technologyvaaralliset aineetjoint operationCBRNE countermeasuresCBRNE detectioncrisis managementsmartphone technologyturvallisuustekniikkakemialliset aseetmyrkylliset aineetkriisinhallinta
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

CCTV-FullyAware: toward end-to-end feasible privacy-enhancing and CCTV forensics applications

2022

It is estimated that over 1 billion Closed-Circuit Television (CCTV) cameras are operational worldwide. The advertised main benefits of CCTV cameras have always been the same; physical security, safety, and crime deterrence. The current scale and rate of deployment of CCTV cameras bring additional research and technical challenges for CCTV forensics as well, as for privacy enhancements. This paper presents the first end-to-end system for CCTV forensics and feasible privacy-enhancing applications such as exposure measurement, CCTV route recovery, CCTV-aware routing/navigation, and crowd-sourcing. For this, we developed and evaluated four complex and distinct modules (CCTVCV [1], OSRM-CCTV [2],…

tekninen rikostutkintatietosuojamachine learningkoneoppiminenyksityisyyskameravalvontaobject detectionvideo surveillancekonenäkönavigationsovellusohjelmatyksilönsuojaprivacy-enhancing technologies2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

Efficient techniques for fault detection and location of multiple controlled Toffoli-based reversible circuit

2021

It is very important to detect and correct faults for ensuring the validity and reliability of these circuits. In this regard, a comparative study with related existing techniques is undertaken. Two techniques to achieve the testability of reversible circuits are introduced that have been improved in terms of quantum cost and fault coverage rate. Considering this aspect, the main focus of these techniques is on the efficient detection and location of faults with 100% accuracy. These techniques for fault detection in reversible circuit design, in addition to being able to produce the correct outputs, can also provide information for fault location that has already been done at a higher cost.…

testcost metricskvanttitietokoneetHardware_PERFORMANCEANDRELIABILITYfault locationkvanttilaskentafault modelsfault detectionreversible circuit
researchProduct

Thermal anomalies detection in a photovoltaic plant using artificial intelligence: Italy case studies

2021

This paper proposes the application of artificial intelligence techniques for the identification of thermal anomalies that occur in a photovoltaic system due to malfunctions or faults, with the aim to limit the energy production losses by detecting faults at an early stage. The proposed approach is based on a Thermographic Non-Destructive Test conducted with Unmanned Aerial Vehicles equipped with a thermal imaging camera, which allows the detection of abnormal operating conditions without interrupting the normal operation of the PV system rapidly and cost-effectively. The thermographic images and videos are automatically inspected using a Convolutional Neural Network, developed by an open-s…

thermal anomaliesbusiness.industryComputer sciencePhotovoltaic systemSettore ING-IND/32 - Convertitori Macchine E Azionamenti Elettriciartificial intelligenceConvolutional neural networkReduction (complexity)Identification (information)photovoltaic systeminfrared thermographyLimit (music)ThermalAutomatic detectionStage (hydrology)Artificial intelligencebusinessEnergy (signal processing)2021 IEEE International Conference on Environment and Electrical Engineering and 2021 IEEE Industrial and Commercial Power Systems Europe (EEEIC / I&CPS Europe)
researchProduct

Reducing the Time to Detect Cyber Attacks : Combining Attack Simulation With Detection Logic

2021

Cyber attacks have become harder to detect, causing the average detection time of a successful data breach to be over six months and typically costing the target organization nearly four million dollars. The attacks are becoming more sophisticated and targeted, leaving unprepared environments easy prey for the attackers. Organizations with working antivirus systems and firewalls may be surprised when they discover their network has been encrypted by a ransomware operator. This raises a serious question, how did the attacks go undetected? The conducted research focuses on the most common pitfalls regarding late or even non-existent detection by defining the root cause behind the failed detec…

threat detectionorganisaatiotTK5101-6720threat analysiscyber defensetietotekniikkacybersecurity frameworktestauscyber attack simulationTelecommunicationsimulointisoctietoturvakyberturvallisuusverkkohyökkäyksetexploitationpalomuurit (tietoturva)
researchProduct

Voltammetric Detection of Lead(II) Using Amide-Cyclam- Functionalized Silica-Modified Carbon Paste Electrodes

2009

2-(4,8,11-Triscarbamoylmethyl-1,4,8,11-tetraazacyclotetradec-1-yl)acetamide (TETAM) derivatives bearing 1, 2, or 4 silylated arms have been synthesized and grafted to the surface of silica gel and ordered mesoporous silica samples. The resulting organic-inorganic hybrids have been incorporated into carbon paste electrodes and applied to the preconcentration electroanalysis of Pb(II). The attractive recognition properties of these cyclam derivatives functionalized with amide pendent groups toward Pb(II) species and the highly porous structure of the adsorbents can be exploited for the selective and sensitive detection of the target analyte. Various parameters affecting the preconcentration a…

titrationsynthesisDPVInorganic chemistrydetectionR4(14)aneN4extractanturea02 engineering and technology01 natural sciencesAnalytical Chemistrychemistry.chemical_compoundAdsorptionSBA15sensorAmideCyclamElectrochemistryComputingMilieux_MISCELLANEOUSsolid/liquid extractionDetection limitleadSilica gelsilica gel010401 analytical chemistryTETAM[CHIM.MATE]Chemical Sciences/Material chemistryMesoporous silica021001 nanoscience & nanotechnologygraftingamide0104 chemical sciencesCarbon paste electrodechemistry[ CHIM.MATE ] Chemical Sciences/Material chemistryKieselgel 600210 nano-technologyAcetamideElectroanalysis
researchProduct

Double copies of blaKPC-3::Tn4401a on an IncX3 plasmid in Klebsiella pneumoniae successful clone ST512 from Italy

2015

ABSTRACT A carbapenem-resistant sequence type 512 (ST512) Klebsiella pneumoniae carbapenemase 3 (KPC-3)-producing K. pneumoniae strain showing a novel variant plasmid content was isolated in Palermo, Italy, in 2014. ST512 is a worldwide successful clone associated with the spread of bla KPC genes located on the IncFIIk pKpQIL plasmid. In our ST512 strain, the bla KPC-3 gene was unusually located on an IncX3 plasmid, whose complete sequence was determined. Two copies of bla KPC-3 ::Tn 4401a caused by intramolecular transposition events were detected in the plasmid.

transposonsequence analysispolymerase chain reactionDrug ResistanceGene DosageSettore MED/42 - Igiene Generale E Applicatabacterial proteinbeta-Lactamaseopen reading framecarbapenemasePlasmidminocyclineplasmid DNAmeropenemPharmacology (medical)geneticscolistincefpodoximeceftazidime610 Medicine & healthCarbapenemBacterialpolymyxin Btimentingene expression regulationbacteriumKlebsiella pneumoniae carbapenemase 3 producing Klebsiella pneumoniae3. Good healthantiinfective agentmicrobial sensitivity testKlebsiella pneumoniaeItalypriority journaltigecyclineMultipleclone (Java method)cefotaxime030106 microbiologyKlebsiella pneumoniae carbapenemase 3tobramycinMicrobial Sensitivity Testsgentamicinpiperacillin plus tazobactamchemistryGene dosageArticleMicrobiology03 medical and health sciencesComplete sequenceClone CellOpen Reading FramesertapenemBacterial Proteinsmultidrug resistanceextensively drug resistant bacteriumAnti-Bacterial AgentcefepimePharmacologylevofloxacinmicrobiologycefoxitinbiochemical phenomena metabolism and nutritionbacterial infections and mycosesVirologyAnti-Bacterial Agents; Bacterial Proteins; Carbapenems; Clone Cells; Drug Resistance Multiple Bacterial; Gene Dosage; Italy; Klebsiella Infections; Klebsiella pneumoniae; Microbial Sensitivity Tests; Open Reading Frames; Plasmids; beta-Lactamases; DNA Transposable Elements; Gene Expression Regulation Bacterial; Pharmacology (medical); Pharmacology; Infectious Diseasesantibiotic sensitivityClone CellsKlebsiella InfectionsceftriaxoneCarbapenemsbacterial genetics0301 basic medicinemolecular cloningSettore MED/07 - Microbiologia E Microbiologia ClinicaKlebsiella pneumoniaeTransposition (music)Drug Resistance Multiple Bacterialpolycyclic compoundsgenetic screeningcell clonecarbapenem derivativeKlebsiella infectionunclassified drugAnti-Bacterial AgentsInfectious Diseasesbacterial genePlasmidsenzymologydoripenemBiologyminimum inhibitory concentrationbeta-Lactamasesbeta lactamaseMechanisms of ResistanceciprofloxacinAmikacin; aztreonam; carbapenemase; cefepime; cefotaxime; cefoxitin; cefpodoxime; ceftazidime; ceftriaxone; ciprofloxacin; colistin; cotrimoxazole; doripenem; doxycycline; ertapenem; gentamicin; imipenem; Klebsiella pneumoniae carbapenemase 3; levofloxacin; meropenem; minocycline; piperacillin plus tazobactam; plasmid DNA; polymyxin B; tigecycline; timentin; tobramycin; unclassified drug; antiinfective agent; bacterial protein; beta lactamase; carbapenem derivative; transposon antibiotic sensitivity; Article; bacterial gene; bacterial genetics; bacterial strain; bacterium; bacterium detection; bacterium isolation; Escherichia coli; extensively drug resistant bacterium; gene dosage; genetic screening; Italy; Klebsiella pneumoniae; Klebsiella pneumoniae carbapenemase 3 producing Klebsiella pneumoniae; minimum inhibitory concentration; molecular cloning; nonhuman; polymerase chain reaction; priority journal; sequence analysis; cell clone; chemistry; drug effects; enzymology; gene expression regulation; genetics; isolation and purification; Klebsiella infection; Klebsiella pneumoniae; metabolism; microbial sensitivity test; microbiology; multidrug resistance; open reading frame; plasmid; transposon Anti-Bacterial Agents; Bacterial Proteins; beta-Lactamases; Carbapenems; Clone Cells; DNA Transposable Elements; Drug Resistance Multiple Bacterial; Gene Dosage; Gene Expression Regulation Bacterial; Italy; Klebsiella Infections; Klebsiella pneumoniae; Microbial Sensitivity Tests; Open Reading Frames; Plasmidsplasmidbacterium isolationEscherichia coliGeneAmikacinbacterium detectionnonhumandoxycyclineisolation and purificationGene Expression Regulation Bacterialbiology.organism_classificationbacterial straincotrimoxazoleOpen reading frameDNA Transposable Elementdrug effectsDNA Transposable Elementsmetabolismaztreonamimipenem
researchProduct

Tracking mite trophic interactions by multiplex PCR

2020

Background A thorough knowledge of trophic webs in agroecosystems is essential to achieve successful biological pest control. Phytoseiid mites are the most efficient natural enemies of tetranychid mites, which include several important pests worldwide. Nevertheless, phytoseiids may feed on other food sources including other microarthropods, plants and even other phytoseiids (intraguild predation), which can interfere with biological control services. Molecular gut content analysis is a valuable tool for characterizing trophic interactions, mainly when working on microarthropods such as mites. We have designed new primers for Phytoseiidae, Tetranychidae and Thysanoptera identification and th…

trophic linksMitesPhytoseiidaebiologyThysanopteraPrey detectionBiological pest controlZoologyplantGeneral Medicinebiology.organism_classificationPredationprey detectionPredatory BehaviorInsect Sciencemolecular diet analysisAnimalsTetranychus urticaePest Control BiologicalMultiplex Polymerase Chain ReactionAcariAgronomy and Crop SciencePredatorIntraguild predationTrophic levelPest Management Science
researchProduct