Search results for "Dino"

showing 10 items of 490 documents

The exposure of healthy volunteers to 200 ppm 1,1,1-trichloroethane increases the concentration of proinflammatory cytokines in nasal secretions

1999

Objectives: Irritating effects of organic solvents have usually been measured by means of questionnaires. The aim of the present study was to evaluate the sensitivity of different methods of detecting subclinical irritating effects. Methods: Twelve healthy, non-smoking students were exposed to 200 ppm and to 20 ppm 1,1,1-trichloroethane in an exposure chamber, using a crossover design. The amounts of interleukins (IL)-1β, IL-6 and IL-8 and prostaglandin E2 (PGE2) in nasal secretions were measured. Mucociliary transport time was determined with the saccharine test. Ciliary beat frequency of nasal epithelial cells was measured with video-interference contrast microscopy. Subjective symptoms w…

AdultMalemedicine.medical_specialtyMucous membrane of nosemedicine.disease_causeDinoprostoneStatistics NonparametricProinflammatory cytokineInternal medicinemedicineHumansTrichloroethanesProstaglandin E2Subclinical infectionCross-Over StudiesInhalationInterleukin-6ChemistryInterleukinsInterleukin-8Public Health Environmental and Occupational HealthCrossover studyNasal MucosaEndocrinologyMucociliary ClearanceImmunologyToxicitySolventsIrritationInterleukin-1medicine.drugInternational Archives of Occupational and Environmental Health
researchProduct

A comparative study of naproxen gel and flufenamic acid gel in the treatment of soft tissue injuries.

1990

One hundred patients were enrolled in a single-blind, randomized, parallel group study to compare naproxen gel (10%) with flufenamic acid gel (3%) for the treatment of soft tissue injuries. Demographic variables, the distribution of diagnoses (tendinitis, bursitis/synovitis, synovitis, periarthritis, epicondylitis) and initial severity of the complaint were similar between the two groups. The gels were applied 2 to 6 times per day, as required, and conventional clinical indices were evaluated at Day 1 (on entry to the study), Day 3 and Day 7. Global assessments of efficacy were made by both physicians and patients at the end of the study. By Day 7 both treatments had produced a highly signi…

AdultMalemedicine.medical_specialtyNaproxenBursitisAdolescentlaw.inventionNaproxenRandomized controlled trialTendinitislawBursitisSynovitismedicineHumansSingle-Blind MethodChildAgedSynovitisbusiness.industryEpicondylitisSoft tissueGeneral MedicineMiddle Agedmedicine.diseaseSurgeryFlufenamic AcidFlufenamic acidAnesthesiaTendinopathySprains and StrainsFemalebusinessGelsmedicine.drugCurrent medical research and opinion
researchProduct

Investigation into the role of phosphodiesterase IV in bronchorelaxation, including studies with human bronchus.

1993

1. We have investigated the role of cyclic nucleotide phosphodiesterase IV (PDE IV) in the relaxation of human bronchus and guinea-pig trachea in vitro and in guinea-pigs in vivo. 2. Functional studies showed that the selective PDE IV inhibitors, rolipram and denbufylline, relaxed human and guinea-pig preparations in vitro. 3. Two clinically used xanthine non-selective PDE inhibitors, theophylline and pentoxifylline, were also effective in these preparations, but were much less potent than the selective agents used. 4. The rank order of potency for the four PDE inhibitors in both species was similar. 5. Biochemical studies indicated that PDE IV was the major PDE isoform present in the human…

AdultMalemedicine.medical_specialtyPhosphodiesterase InhibitorsGuinea PigsBiologyIn Vitro TechniquesPentoxifyllinechemistry.chemical_compoundTheophyllineIn vivoInternal medicinemedicineAnimalsHumansTheophyllineheterocyclic compoundsPentoxifyllineRolipramAgedPharmacologyCyclic nucleotide phosphodiesterasePhosphoric Diester HydrolasesIsoproterenolMiddle AgedXanthinemusculoskeletal systemAsthmaPyrrolidinonesBronchodilator AgentsCyclic Nucleotide Phosphodiesterases Type 4IsoenzymesBronchodilatationenzymes and coenzymes (carbohydrates)Disease Models AnimalEndocrinologychemistryEnzyme inhibitor3'5'-Cyclic-AMP PhosphodiesterasesXanthinesbiology.proteinFemalesense organsRoliprammedicine.drugcirculatory and respiratory physiologyResearch Article
researchProduct

Effects of 12-wk eccentric calf muscle training on muscle-tendon glucose uptake and SEMG in patients with chronic Achilles tendon pain

2014

High-load eccentric exercises have been a key component in the conservative management of chronic Achilles tendinopathy. This study investigated the effects of a 12-wk progressive, home-based eccentric rehabilitation program on ankle plantar flexors' glucose uptake (GU) and myoelectric activity and Achilles tendon GU. A longitudinal study design with control ( n = 10) and patient ( n = 10) groups was used. Surface electromyography (SEMG) from four ankle plantar flexors and GU from the same muscles and the Achilles tendon were measured during submaximal intermittent isometric plantar flexion task. The results indicated that the symptomatic leg was weaker ( P < 0.05) than the asymptomatic…

AdultMalemedicine.medical_specialtyPhysiologyGlucose uptakeMusculoskeletal Physiological PhenomenaPainAchilles TendonEducationPhysical medicine and rehabilitationMuscular DiseasesPhysiology (medical)medicineHumansEccentricIn patientLongitudinal StudiesMuscle Skeletalta315ExerciseLegAchilles tendonElectromyographybusiness.industryBiomechanicsmusculoskeletal systemmedicine.diseaseAchilles tendon painExercise TherapyTendonbody regionsGlucosemedicine.anatomical_structureCase-Control StudiesFemaleAnkleTendinopathybusinessAnkle JointJournal of Applied Physiology
researchProduct

Patients' experiences of shoulder problems prior to and following intervention.

2011

Health can be viewed from several perspectives. It has been shown that impingement of the shoulder leads to functional inability and decreased life quality. The aim of this study was to investigate the complexity of the effect of shoulder problems and discern and describe what it entails to be a patient suffering from shoulder problems. The study delineated patients' situations prior to and following medical intervention. This study is qualitative, and the data were collected through focus group interviews. Interviews with 26 respondents aged 43-63 (mean age 53) were made in 2005-2007. The sample group consisted of patients with supraspinatus tendinitis receiving either conservative treatme…

AdultMalemedicine.medical_specialtyRehabilitationbusiness.industrymedicine.medical_treatmentMEDLINEPhysical Therapy Sports Therapy and RehabilitationContext (language use)Middle AgedFocus groupInternational Classification of Functioning Disability and HealthShoulder PainIntervention (counseling)Preoperative PeriodTendinopathyPhysical therapyMedicineHumansFemaleMeaning (existential)Postoperative PeriodThematic analysisbusinessPhysiotherapy theory and practice
researchProduct

Prostaglandin E2 activates the ciliary beat frequency of cultured human nasal mucosa via the second messenger cyclic adenosine monophosphate.

2001

Prostaglandins influence the ciliary beat frequency (CBF) of ciliated nasal epithelial cells and a stimulatory effect has been described for prostaglandin E2 (PGE2). Until now, it is not known whether PGE2 has direct ciliostimulatory properties or acts through a second messenger. In this study we investigated whether cyclic adenosine monophosphate (cAMP) is implicated in the signal transduction pathway of PGE2-induced activation of CBF. Ciliated cells of the nasal mucosa were cultured for up to 5 days whereafter the culture medium was removed and the cells were incubated with different concentrations of test solutions. The ciliated cells were recorded under a phase-contrast microscope and v…

AdultMalemedicine.medical_specialtyStimulationMucous membrane of noseBiologyIn Vitro TechniquesSecond Messenger SystemsDinoprostonechemistry.chemical_compoundInternal medicinemedicineCyclic AMPHumansCyclic adenosine monophosphateCiliaProstaglandin E2Cells CulturedAgedDose-Response Relationship DrugColforsinEpithelial CellsGeneral MedicineMiddle AgedEpitheliumCell biologyNasal Mucosamedicine.anatomical_structureEndocrinologyOtorhinolaryngologychemistryCell cultureSecond messenger systemFemaleSignal transductionmedicine.drugSignal TransductionEuropean archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery
researchProduct

Limb Ischemic Conditioning Induces Oxidative Stress Followed by a Correlated Increase of HIF-1α in Healthy Volunteers.

2019

Background Local and remote ischemic preconditioning has been used as a protective intervention against ischemia/reperfusion (I/R) damage in several preclinical and clinical studies. However, its physiological mechanisms are not completely known. I/R increases the production of reactive oxygen species, which also serve as messengers for a variety of functions. Hypoxia-inducible factor 1 alpha (HIF-1α) is probably the most important transcription factor mediator of hypoxic signaling. Objective We hypothesized that limb ischemic conditioning (LIC) induces a local oxidative/nitrosative stress and a correlated increase of HIF-1α plasma levels. Methods An observational, prospective, and single-c…

AdultMalemedicine.medical_specialtyTime FactorsIschemiaOxidative phosphorylation030204 cardiovascular system & hematologymedicine.disease_causeDinoprost030218 nuclear medicine & medical imagingUpper Extremity03 medical and health scienceschemistry.chemical_compoundYoung Adult0302 clinical medicineInternal medicineBlood plasmamedicineHumansProspective StudiesNitriteIschemic PreconditioningNitriteschemistry.chemical_classificationReactive oxygen speciesbusiness.industryGeneral MedicineVenous bloodmedicine.diseaseHypoxia-Inducible Factor 1 alpha SubunitHealthy VolunteersUp-RegulationOxidative StressEndocrinologychemistryNitrosative StressRegional Blood FlowSpainIschemic preconditioningSurgeryFemaleTherapeutic OcclusionCardiology and Cardiovascular MedicinebusinessOxidative stressBiomarkersAnnals of vascular surgery
researchProduct

Individual Region- and Muscle-specific Hamstring Activity at Different Running Speeds

2019

Introduction \ud Hamstring strain injuries typically occur in the proximal biceps femoris long head (BFlh) at high running speeds. Strain magnitude seems to be the primary determinant of strain injury, and may be regulated by muscle activation. In running, BFlh strain is largest in the proximal region, especially at high speeds. However, region-specific activity has not been examined. This study examined the proximal–distal and intermuscular activity of BFlh and semitendinosus (ST) as a function of increasing running speed.\ud \ud Methods \ud Thirteen participants ran at steady speeds of 4.1 (slow), 5.4 (moderate), and 6.8 m·s−1 (fast) on a treadmill. Region- and muscle-specific EMG activit…

AdultMalemedicine.medical_specialtybiceps femorisrasitusvammatQP301.H75_Physiology._Sport.Hamstring MusclesPhysical Therapy Sports Therapy and RehabilitationStrain (injury)ElectromyographyIsometric exerciseBiologyBicepsRunningjuoksuTendonsYoung Adult03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationstrain injuriesIsometric ContractionliikuntakykymedicineHumansOrthopedics and Sports MedicineTreadmillHamstring injurymedicine.diagnostic_testGV557_SportsElectromyographyproximal-distal differencesinjury mechanism030229 sport sciencesSwingmedicine.diseaseBiomechanical Phenomenamuscle mechanicslocomotionelektromyografiaSprains and StrainssemitendinosusbiomekaniikkaHamstring
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Shock wave therapy versus conventional surgery in the treatment of calcifying tendinitis of the shoulder.

2001

A prospective quasirandomized study was performed to compare the effects of surgical extirpation (Group I, 29 patients) with the outcome after high-energy extracorporeal shock wave therapy (Group II, 50 patients; 3,000 impulses of an energy flux density of 0.6 mJ/mm2) in patients with a chronic calcifying tendinitis in the supraspinatus tendon. Symptoms and demographic data of the two groups were comparable. According to the University of California Los Angeles Rating System, the mean score in Group I was 30 points with 75% good or excellent results after 12 months, and 32 points with 90% good or excellent results after 24 months. Radiologically, there was no calcific deposit in 85% of the …

AdultMalemedicine.medical_specialtymedicine.medical_treatmentRadiographyLithotripsylaw.inventionHigh-Energy Shock WavesTendonsRandomized controlled trialTendinitislawmedicineHumansOrthopedics and Sports MedicineProspective StudiesProspective cohort studyAgedbusiness.industryShoulder JointCalcinosisGeneral MedicineMiddle Agedmedicine.diseaseSurgeryClinical trialRadiographymedicine.anatomical_structureOrthopedic surgeryTendinopathyUpper limbSurgeryFemalebusinessClinical orthopaedics and related research
researchProduct