Search results for "Drosophila."

showing 9 items of 769 documents

Fitness and viability of small populations : the effects of genetic drift, inbreeding, and interpopulation hybridization

2012

sisäsiitosdrift loadluonnonvalintaDrosophila littoralismahlakärpäsetfitness surrogatesoutbreeding depressiongeneettinen muuntelusatunnaisajautuminenpopulaatiotpurgingristeytysheterosissukusiitosinbreeding depression
researchProduct

Photosensitive Alternative Splicing of the Circadian Clock Gene timeless Is Population Specific in a Cold-Adapted Fly, Drosophila montana

2018

sopeutuminenalternative splicinglight-dark cyclegeenitpopulaatiogenetiikkamahlakärpäsetta1184ta1181temperatureDrosophila MontanaphotoperiodvuorokausirytmiG3: Genes, Genomes, Genetics
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

The effects of inbreeding, crossbreeding and stress on metabolic rate in Drosophila littoralis

2009

suolaDrosophila littoralissukusiitossaltkärpäsetstressiaineenvaihduntafitnesskelpoisuus
researchProduct

Role of odorant-binding proteins in Drosophila melanogaster chemosensory perception

2019

Chemoperception is used by animals to detect nutritive food and avoid toxic compounds. It also allows animals to identify suitable ecological niche and mating partners. Like many other insects, Drosophila melanogaster possesses a very sensitive chemosensory ability and can detect and discriminate a wide panel of semiochemicals. Chemosensory detection is mostly mediated by olfactory and gustatory systems involving several multigene chemoreceptor families. Volatile and non-volatile chemical compounds entering the sensory organ (sensillum) must be solubilized before being transported through the hydrophilic sensillum lymph bathing the dendrites of chemosensory neurons. These perireceptor event…

tastechemoperception[SDV.BBM] Life Sciences [q-bio]/Biochemistry Molecular Biologyperireceptor eventsgoût[SDV.BBM]Life Sciences [q-bio]/Biochemistry Molecular Biologyodorant-binding proteinschimioperceptionévénement périrecepteurdrosophilaprotéines de liaison aux odorantsolfaction
researchProduct

Chemicals and chemoreceptors: ecologically relevant signals driving behavior in Drosophila

2015

Insects encounter a vast repertoire of chemicals in their natural environment, which can signal positive stimuli like the presence of a food source, a potential mate, or a suitable oviposition site as well as negative stimuli such as competitors, predators, or toxic substances reflecting danger. The presence of specialized chemoreceptors like taste and olfactory receptors allows animals to detect chemicals at short and long distances and accordingly, trigger proper behaviors toward these stimuli. Since the first description of olfactory and taste receptors in Drosophila melanogaster 15 years ago, our knowledge on the identity, properties, and function of specific chemoreceptors has increase…

tastelcsh:QH540-549.5receptorfungilcsh:Evolutionlcsh:QH359-425Ecology and EvolutionDrosophilalcsh:Ecologyecological nicherepulsionOlfactionattractionFrontiers in Ecology and Evolution
researchProduct

Desarrollo de modelos experimentales de LGMDD2 y rastreo de fármacos

2023

La distrofia muscular de cinturas tipo D2 (Limb-girdle muscular dystrophy type D2, LGMDD2) es una enfermedad genética ultra rara para la cual no existe tratamiento. Las principales características clínicas de la LGMDD2 son la debilidad y degeneración muscular progresiva que afecta a las cinturas pélvica y escapular de forma predominante. En 2013 se identificó la LGMDD2 como una miopatía autosómica dominante causada por una mutación en el gen de la transportina 3 (TNPO3), dando como resultado una proteína mutante con una extensión de 15 aminoácidos adicionales: TNPO3mut. TNPO3 es una β-importina responsable de la importación nuclear de proteínas ricas en serina/arginina (proteínas SR), invol…

terapia génicaUNESCO::CIENCIAS DE LA VIDA::Biología animal (Zoología) ::Invertebradosdistrofia muscular de cinturas tipo D2reposicionamiento de fármacosmioblastos inmortalizadosUNESCO::CIENCIAS DE LA VIDA::Biología celular::Cultivo celularCRISPR-Cas9modelos experimentalesdrosophila melanogasterUNESCO::CIENCIAS MÉDICAS ::Farmacología
researchProduct

The prolyl-isomerase PIN1 is essential for nuclear Lamin-B structure and function and protects heterochromatin under mechanical stress.

2021

Summary: Chromatin organization plays a crucial role in tissue homeostasis. Heterochromatin relaxation and consequent unscheduled mobilization of transposable elements (TEs) are emerging as key contributors of aging and aging-related pathologies, including Alzheimer’s disease (AD) and cancer. However, the mechanisms governing heterochromatin maintenance or its relaxation in pathological conditions remain poorly understood. Here we show that PIN1, the only phosphorylation-specific cis/trans prolyl isomerase, whose loss is associated with premature aging and AD, is essential to preserve heterochromatin. We demonstrate that this PIN1 function is conserved from Drosophila to humans and prevents…

transposonsNeocortexMiceHeterochromatinProlyl isomeraseDrosophila ProteinsBiology (General)PhosphorylationRNA Small InterferingTissue homeostasisCells CulturedSettore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniNeuronsLamin Type BChemistryHP1phosphorylationneurodegenerationnuclear envelopePeptidylprolyl IsomeraseCell biologyDrosophila heterochromatin HP1 Lamin mechanical stress neurodegeneration nuclear envelope phosphorylation PIN1 transposonsNuclear laminaDrosophilaRNA InterferencePremature agingQH301-705.5HeterochromatinNuclear EnvelopeDrosophila; heterochromatin; HP1; Lamin; mechanical stress; neurodegeneration; nuclear envelope; phosphorylation; PIN1; transposonsSettore BIO/11 - Biologia MolecolareSettore MED/08 - Anatomia PatologicaGeneral Biochemistry Genetics and Molecular BiologyPIN1Alzheimer DiseaseSettore MED/05 - Patologia ClinicaAnimalsHumansHeterochromatin maintenancemechanical stressheterochromatinmechanical streMice Inbred C57BLNIMA-Interacting Peptidylprolyl IsomeraseChromobox Protein Homolog 5DNA Transposable ElementsHeterochromatin protein 1Stress MechanicalLaminLaminCell reports
researchProduct

(A,B) In vivo GCaMP6f signals recorded in layers M1, M5 and M9/10 of Mi1 (A) and Tm3 (B) neurons, before (blue, green) and after (gray, red) applicat…

2019

Sensory systems sequentially extract increasingly complex features. ON and OFF pathways, for example, encode increases or decreases of a stimulus from a common input. This ON/OFF pathway split is thought to occur at individual synaptic connections through a sign-inverting synapse in one of the pathways. Here, we show that ON selectivity is a multisynaptic process in the Drosophila visual system. A pharmacogenetics approach demonstrates that both glutamatergic inhibition through GluClα and GABAergic inhibition through Rdl mediate ON responses. Although neurons postsynaptic to the glutamatergic ON pathway input L1 lose all responses in GluClα mutants, they are resistant to a cell-type-specifi…

visionQH301-705.5GABA AgentsScienceModels Neurological610Sensory systemBiologyStimulus (physiology)distributed codingGeneral Biochemistry Genetics and Molecular BiologySynapseglutamatergic inhibition03 medical and health sciencesGlutamatergic0302 clinical medicinePostsynaptic potentialOff pathwayInterneuronsAnimalsVisual PathwaysExcitatory Amino Acid AgentsBiology (General)030304 developmental biology0303 health sciencesGeneral Immunology and MicrobiologyGABAergic inhibitionD. melanogasterON selectivityGeneral Neurosciencefeature extractionQRGeneral MedicineD. melanogaster; GABAergic inhibition; ON selectivity; distributed coding; feature extraction; glutamatergic inhibition; neuroscience; visionVisual PerceptionMedicineGabaergic inhibitionDrosophilaSelectivityNeuroscience030217 neurology & neurosurgeryResearch ArticleNeuroscience
researchProduct