Search results for "EB"

showing 10 items of 15658 documents

The filter and calibration wheel for the ATHENA wide field imager

2016

The planned filter and calibration wheel for the Wide Field Imager (WFI) instrument on Athena is presented. With four selectable positions it provides the necessary functions, in particular an UV/VIS blocking filter for the WFI detectors and a calibration source. Challenges for the filter wheel design are the large volume and mass of the subsystem, the implementation of a robust mechanism and the protection of the ultra-thin filter with an area of 160 mm square. This paper describes performed trade-offs based on simulation results and describes the baseline design in detail. Reliable solutions are envisaged for the conceptual design of the filter and calibration wheel. Four different varian…

010302 applied physicsComputer scienceDetectorFilter wheel mechanism FEM structural and acoustic analysis ATHENA WFIVolume (computing)Blocking (statistics)01 natural sciencesSquare (algebra)Settore FIS/05 - Astronomia E AstrofisicaPosition (vector)Filter (video)0103 physical sciencesElectronic engineeringCalibration010303 astronomy & astrophysicsSimulation
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

2018

CrN thin films with an N/Cr ratio of 95% were deposited by reactive magnetron sputtering onto (0 0 0 1) sapphire substrates. X-ray diffraction and pole figure texture analysis show CrN (1 1 1) epitaxial growth in a twin domain fashion. By changing the nitrogen versus argon gas flow mixture and the deposition temperature, thin films with different surface morphologies ranging from grainy rough textures to flat and smooth films were prepared. These parameters can also affect the CrN x system, with the film compound changing between semiconducting CrN and metallic Cr2N through the regulation of the nitrogen content of the gas flow and the deposition temperature at a constant deposition pressur…

010302 applied physicsMaterials scienceAcoustics and Ultrasonics02 engineering and technologyPole figure021001 nanoscience & nanotechnologyCondensed Matter PhysicsMicrostructure01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsElectrical resistivity and conductivitySputteringSeebeck coefficient0103 physical sciencesThermoelectric effectsense organsTexture (crystalline)Thin filmComposite material0210 nano-technologyJournal of Physics D: Applied Physics
researchProduct

ABSOLUTE THERMOELECTRIC POWER OF Pb–Sn ALLOYS

2011

International audience; In this work, absolute thermoelectric power (ATP) of Pb, Sn, Pb-20 wt.% Sn, Pb-40 wt.% Sn, Pb-60 wt.% Sn, Pb-80 wt.% Sn are measured. Measurements are performed in a temperature gradient furnace from 20 degrees C to 500 degrees C, for both solid and liquid states. Temperatures are measured with T-type copper-constantan thermocouples, while voltage signal between copper electrodes of those thermocouples is recorded in order to calculate ATP of the sample metal.

010302 applied physicsMaterials scienceAnalytical chemistryStatistical and Nonlinear Physics[CHIM.MATE]Chemical Sciences/Material chemistry02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics7. Clean energy01 natural sciencesMetalCopper electrodeTemperature gradientThermocouplevisual_artSeebeck coefficient0103 physical sciencesvisual_art.visual_art_medium0210 nano-technologyVoltageModern Physics Letters B
researchProduct

Ultra-Wide Band Gap in Two-Dimensional Phononic Crystal with Combined Convex and Concave Holes

2017

A phononic crystal with an ultra‐wide band gap is proposed, whose unit cell consists of a cross‐like concave hole in the center and four square convex holes at the corners. The dispersion relations, modal kinetic energy ratio, and eigenmodes at edges of the band gaps are investigated by using the finite element method. The influence of the geometrical parameters of the convex and concave holes on the band gaps is further analyzed. After optimization, an ultra‐wide band gap with gap‐to‐midgap ratio of 156.0% is achieved, with the filling fraction keeping a relative small value. Numerical results illustrate that the combination of convex and concave holes is a practicable direction for struct…

010302 applied physicsMaterials scienceCondensed matter physicsBand gapRegular polygonUltra-wideband02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter PhysicsKinetic energy01 natural sciencesSquare (algebra)Finite element methodCrystalDispersion relation0103 physical sciencesGeneral Materials Science0210 nano-technologyphysica status solidi (RRL) - Rapid Research Letters
researchProduct

Hole localization in thermoelectric half-Heusler (Zr0.5Hf0.5)Co(Sb1−xSn ) thin films

2019

Abstract The (Ti, Zr, Hf)Co(Sb 1 − x Snx) material class has recently come into focus as an attractive p-type high-temperature thermoelectric material. This study experimentally demonstrates that homogeneous, highly textured (Zr0.5Hf0.5)Co(Sb 1 − x Snx) thin films can be grown on single crystalline MgO. By varying the sputter power, samples with both positive and negative Seebeck coefficient can be grown. The underlying reason for the sign change is the segregation of Sn nano-inclusions, which lower the effective doping of the half-Heusler matrix. Similarly the Hall constant also switches sign at low temperatures, which is modeled assuming semi-metal behavior and low temperature hole locali…

010302 applied physicsMaterials scienceCondensed matter physicsDopingMetals and Alloys02 engineering and technologySurfaces and Interfaces021001 nanoscience & nanotechnologyThermoelectric materials01 natural sciencesAcceptorSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsSputteringElectrical resistivity and conductivitySeebeck coefficient0103 physical sciencesThermoelectric effectMaterials ChemistryThin film0210 nano-technologyThin Solid Films
researchProduct

Experimental and numerical investigation on a new FSW based metal to composite joining technique

2018

Abstract In the last decades, different techniques were proposed to join aluminum sheets with composites materials. Each of them has advantages and weak points over the others and new techniques and patents are continuously developed to overcome these difficulties. In this paper an experimental and numerical investigation on a new Friction Stir Welding based approach to mechanically join AA6082-T6 to self-reinforced polypropylene is presented. The aluminum sheet is pre-holed along both the sides of the weld line and a pinless tool generates the heat and pressure needed to prompt back-extrusion of the composite. New experimental fixtures and hole designs were investigated in order to enhance…

010302 applied physicsMaterials scienceFSWStrategy and ManagementComposite numberAluminum AlloyProcess (computing)Mechanical engineeringWeld line02 engineering and technologyManagement Science and Operations ResearchMechanical resistance021001 nanoscience & nanotechnology01 natural sciencesIndustrial and Manufacturing EngineeringStrategy and Management1409 Tourism Leisure and Hospitality Management0103 physical sciencesFriction stir weldingJoin (sigma algebra)Dissimilar jointThermoplastic compositePolypropylene0210 nano-technologySettore ING-IND/16 - Tecnologie E Sistemi Di LavorazioneJournal of Manufacturing Processes
researchProduct

Quartz resonators for penning traps toward mass spectrometry on the heaviest ions

2020

We report on cyclotron frequency measurements on trapped 206,207Pb+ ions by means of the non-destructive Fourier-transform ion-cyclotron-resonance technique at room temperature. In a proof-of-principle experiment using a quartz crystal instead of a coil as a resonator, we have alternately carried out cyclotron frequency measurements for 206Pb+ and 207Pb+ with the sideband coupling method to obtain 21 cyclotron-frequency ratios with a statistical uncertainty of 6 × 10−7. The mean frequency ratio R¯ deviates by about 2σ from the value deduced from the masses reported in the latest Atomic Mass Evaluation. We anticipate that this shift is due to the ion–ion interaction between the simultaneousl…

010302 applied physicsMaterials scienceSidebandCyclotronMass spectrometry01 natural sciences7. Clean energyAtomic mass010305 fluids & plasmaslaw.inventionIonCrystalResonatorPhysics::Plasma Physicslaw0103 physical sciencesAtomic physicsddc:620InstrumentationQuartz
researchProduct

Analytic $JV$ -Characteristics of Ideal Intermediate Band Solar Cells and Solar Cells With Up and Downconverters

2017

The ideal diode equation is regularly used to describe the $\textit {JV}$ -characteristic of single junction solar cells. The connection between the diode equation and fundamental physics is the application of the Boltzmann approximation to describe the fluxes of photons emitted by the cell. In this paper, this approximation is used to derive analytic $\textit {JV}$ -characteristics for three photovoltaic high-efficiency concepts, intermediate band solar cells, and solar cells optically coupled to up and downconverters. These three concepts share the common feature that they allow excitation of electrons between at least three energy levels, which assures a better utilization of the solar s…

010302 applied physicsPhysicsTheory of solar cellsPhotonbusiness.industryPhotovoltaic systemShockley–Queisser limit02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesElectronic Optical and Magnetic MaterialsComputational physicsMultiple exciton generationsymbols.namesakeOptics0103 physical sciencesBoltzmann constantsymbolsElectrical and Electronic EngineeringConnection (algebraic framework)0210 nano-technologybusinessEnergy (signal processing)IEEE Transactions on Electron Devices
researchProduct

Topological two-dimensional Su–Schrieffer–Heeger analog acoustic networks: Total reflection at corners and corner induced modes

2021

In this work, we investigate some aspects of an acoustic analogue of the two-dimensional Su-Schrieffer-Heeger model. The system is composed of alternating cross-section tubes connected in a square network, which in the limit of narrow tubes is described by a discrete model coinciding with the two-dimensional Su-Schrieffer-Heeger model. This model is known to host topological edge waves, and we develop a scattering theory to analyze how these waves scatter on edge structure changes. We show that these edge waves undergo a perfect reflection when scattering on a corner, incidentally leading to a new way of constructing corner modes. It is shown that reflection is high for a broad class of edg…

010302 applied physicsPhysics[PHYS]Physics [physics]Total internal reflectionWork (thermodynamics)Condensed Matter - Mesoscale and Nanoscale PhysicsScatteringGeneral Physics and AstronomyClassical Physics (physics.class-ph)FOS: Physical sciencesPhysics - Classical Physics02 engineering and technologyEdge (geometry)021001 nanoscience & nanotechnologyTopology01 natural sciencesSquare (algebra)0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)Reflection (physics)Limit (mathematics)Scattering theory0210 nano-technologyComputingMilieux_MISCELLANEOUS
researchProduct