Search results for "ECR-ionilähteet"

showing 2 items of 2 documents

ECR-ionilähteiden plasmapotentiaali ja ambipolaarinen diffuusio

2005

ionitECR-ionilähteetplasmapotentiaaliplasmatekniikkafysiikkaambipolaarinen diffuusio
researchProduct

Quasi-periodical kinetic instabilities in minimum-B confined plasma

2022

We present the results of an experimental investigation of quasi-periodical kinetic instabilities exhibited by magnetically confined electron cyclotron resonance heated plasmas. The instabilities were detected by measuring plasma microwave emission, electron losses, and wall bremsstrahlung. The instabilities were found to be grouped into fast sequences of periodic plasma losses, separated by ∼100 µs between the bursts, followed by 1–10 ms quiescent periods before the next event. Increasing the plasma energy content by adjusting the plasma heating parameters, in particular the magnetic field strength, makes the instabilities more chaotic in the time domain. Statistical analysis reveals that …

plasma confinemention sourcessyklotronitPhysicsQC1-999ECR-ionilähteetGeneral Physics and Astronomyplasma heatingplasma instabilitiescyclotron resonancehiukkaskiihdyttimetplasmafysiikkaAIP Advances
researchProduct