Search results for "EES"

showing 10 items of 2276 documents

Two Relevant Forecasting Problems for Practitioners in Finance: Equity Risk Premium and Non-Performing Loans

2021

The thesis aims to substantiate whether macroeconomic factors indicators are relevant to predict both in-sample and out-of-sample assets' future performance focusing on two well-studied themes in financial economics and banking: First, the ability to predict the equity risk premium, and second, the macroeconomic determinants of non-performing loans (NPL) rates. The dissertation is divided in three chapters. Chapter 1, entitled "Forecasting the equity risk premium in the European Monetary Union", investigates the capacity of multiple economic and technical variables to predict the Euro area equity risk premium. The chapter examines the performance of several variables that could be good pred…

equity risk premiumnon-performing loansforecastingUNESCO::CIENCIAS ECONÓMICASregression treesdynamic panel data:CIENCIAS ECONÓMICAS [UNESCO]asset allocation
researchProduct

Item Response Trees: a recommended method for analyzing categorical data in behavioral studies

2015

Behavioral data are notable for presenting challenges to their statistical analysis, often due to the difficulties in measuring behavior on a quantitative scale. Instead, a range of qualitative alternative responses is recorded. These can often be understood as the outcome of a sequence of binary decisions. For example, faced by a predator, an individual may decide to flee or stay. If it stays, it may decide to freeze or display a threat and if it displays a threat, it may choose from several alternative forms of display. Here we argue that instead of being analyzed using traditional nonparametric statistics or a series of separate analyses split by response categories, this kind of data ca…

escalationpredator-prey interactionsBiologyMachine learningcomputer.software_genreGeneralized linear mixed modelSoftwareethologyrepeatabilityCategorical variableEcology Evolution Behavior and Systematicsbehavioral analysisSequenceta112business.industryScale (chemistry)Nonparametric statisticsRitem response theoryresponse treesOutcome (probability)ordinal dataRange (mathematics)ta1181Animal Science and Zoologycategorical dataArtificial intelligencebusinesscomputerGLMMBehavioral Ecology
researchProduct

Kalvosulkeisista kokonaisvaltaiseksi elämykseksi : esitysgrafiikka- ja puhe-esitys multimodaalisena tekstinä

2016

Esitysgrafiikkaesitysten hyödyntäminen on osa jokapäiväisiä rutiineja hyvin monenlaisissa organisaatioissa. Tutkimusta tällaisten puheen havainnollistamismateriaaliksi luotujen diaesitysten käytöstä on Suomessa tehty kuitenkin hyvin vähän suhteessa siihen, kuinka laajalti niitä eri yhteyksissä käytetään. Tässä tutkielmassa huomio kohdistetaan puhe-esityksen ja sen havainnollistamismateriaalina esitetyn esitysgrafiikkaesityksen yhteistoimintaan. Ensimmäinen tutkimuskysymykseni on, kuinka puhe ja sitä havainnollistava esitysgrafiikkaesitys rakentuvat yhdessä multimodaaliseksi tekstiksi. Tarkentavina alakysymyksinä ensimmäisessä tutkimuskysymyksessäni on, (1) millaisin kielellisin ja visuaalis…

esitysgrafiikkasidoksisuuskoheesiovisuaalinen viestintähavainnollistaminenpuheetmultimodaalisuustekstintutkimus
researchProduct

Spain and the international scientific conferences on polio, 1940s-1960s

2010

The development of international health from a historical point of view has undergone major advances in recent times and constitutes a substantial part of the current agenda for historians of medicine. Within this framework, and focussing on a specific case study (international responses to poliomyelitis outbreaks in the 20th century), we explore the main actions and achievements of agencies such as the WHO and other private and international scientific organizations. Furthermore, this paper seeks to identify the Spanish presence and absence in these activities, their causes and consequences.

españaEconomic growthconferències internacionals sobre pòlioConferències internacionals sobre poliComitès d'experts de la OMSeducationEspaña:CIENCIAS DE LA VIDA::Inmunología ::Vacunas [UNESCO]poliomielitisConferencias internacionales sobre polioeuropean association against poliomyelitisassociació europea enfront de la poliomielitissegle XXPoliomielitisSegle XXinternational conferences on polioUNESCO::CIENCIAS DE LA VIDA::VirologíaHistory and Philosophy of ScienceMedicineEspanyaComités de expertos de la OMShealth care economics and organizationsUNESCO::CIENCIAS DE LA VIDA::Inmunología ::Vacunasbusiness.industryWHO expert committeesasociación europea frente a la poliomielitisInternational healthEuropean Association against Poliomyelitis20th centuryGeneral Medicine:CIENCIAS DE LA VIDA::Virología [UNESCO]Congresses as TopicHistory 20th Century:CIENCIAS MÉDICAS [UNESCO]medicine.diseaseconferencias internacionales sobre polioPoliomyelitisespanyaSpaincomités de expertos de la OMSUNESCO::CIENCIAS MÉDICASAsociación europea frente a la poliomielitisInternational Conferences on Poliosiglo XXAssociació europea davant la poliomielitisbusinessSiglo XXWHO Expert CommitteesPoliomyelitis
researchProduct

Small agency and precarious residency in Afghan refugee families

2020

This chapter examines agency and ways of enduring suffering in Afghan families in a small Finnish town. Three stories, where the mothers and children have lived in Finland for some years already, but the fathers have arrived during the 2015 large-scale migration, are presented and analysed. Ethnographic methods are used in enquiring how family members endure suffering when they are faced with the threat of deportation of a family member. Our results show that fathers’ precarious residency has an impact on family members’ agency. First, the informants were enduring alone, and thus the social element, being able to share one’s struggles of enduring, was missing. Second, it was not only one ty…

etnografiaperheenjäsenetoleskeluluvatPolitical scienceAfghan refugeesAgency (sociology)toimijuuskärsimysCriminologyperheetmaastakarkotuspakolaisetmaahanmuuttajat
researchProduct

Effetti del pascolamento della sulla e/o della loiessa per 8 o 24 ore sul comportamento alimentare e sulla produzione lattiero-casearia di pecore Com…

2008

This experiment aimed to examine the effects of the utilization of monocultures of ryegrass (R), sulla (S) or both of them (RS), and the prolongation of daily grazing from 8 h (8:00-16:00) to 24 h, evaluating behaviour, selectivity, intake and milk and cheese production of ewes at pasture. The experiment involved 42 Comisana ewes averaging 146±55 days in milk, divided into 6 homogeneous groups which, since 19th April for 42 days, continuously grazed under a stocking rate of 34 ewes/ha. Ewes involving in eating activity were higher in R and for 24-h grazing, in relation to lower intake rate. RS ewes reduced eating time and increased lying activity. During daytime, the eating gradually decrea…

ewes sulla ryegrass daily grazing time feeding behaviour milk cheese
researchProduct

Implementación de un experimento de selección adversa en clase de microeconomía

2010

En este trabajo presentamos los materiales y resultados de un experimento economico realizado en una clase de Microeconomia Intermedia. Hemos realizado una serie de modificaciones y recomendaciones sobre el experimento de seleccion adversa de Bergstrom y Miller 2000 (el analisis del mercado de coches usados, capitulo 12) que consideramos permiten una mejor implementacion del mismo. La realizacion de este experimento fomenta el aprendizaje activo y consigue que los estudiantes comprendan mejor la naturaleza del problema de asimetria de la informacion.

experimento económico; selección adversa; EEESTeoría Económicaselección adversaEEESUNESCO::CIENCIAS ECONÓMICASexperimento económicolcsh:Llcsh:L7-991:CIENCIAS ECONÓMICAS [UNESCO]lcsh:Education (General)lcsh:Education
researchProduct

Machine learning for mortality analysis in patients with COVID-19

2020

This paper analyzes a sample of patients hospitalized with COVID-19 in the region of Madrid (Spain). Survival analysis, logistic regression, and machine learning techniques (both supervised and unsupervised) are applied to carry out the analysis where the endpoint variable is the reason for hospital discharge (home or deceased). The different methods applied show the importance of variables such as age, O2 saturation at Emergency Rooms (ER), and whether the patient comes from a nursing home. In addition, biclustering is used to globally analyze the patient-drug dataset, extracting segments of patients. We highlight the validity of the classifiers developed to predict the mortality, reaching…

feature importanceComputer scienceHealth Toxicology and MutagenesisPneumonia ViralDecision treelcsh:MedicineSample (statistics)Machine learningcomputer.software_genreLogistic regressionArticlesurvival analysisBiclustering03 medical and health sciencesBetacoronavirus0302 clinical medicineMachine learningRisk of mortalitygraphical modelsHumans030212 general & internal medicineGraphical modelPandemicsSurvival analysisInformática0303 health sciences030306 microbiologybusiness.industrySARS-CoV-2Decision Treeslcsh:RPublic Health Environmental and Occupational HealthCOVID-19Decision ruleSurvival analysisFeature importancemachine learningSpainArtificial intelligenceGraphical modelsbusinessCoronavirus Infectionscomputer
researchProduct

Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

2020

 Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

filosofitkapitalismimetafysiikkatietotekniikkainformaatiokoneetkulttuurifilosofiayhteiskuntafilosofialuovuusteknologiaDeleuze GillessynteesiLektiotGuattari FélixmateriaalisuusAjatus
researchProduct

Krāpnieciska darījuma konstatēšanas īpatnības nodokļu tiesībās

2018

Maģistra darbs ir veltīts krāpniecisko darījumu konstatēšanas īpatnību noskaidrošanai nodokļu tiesībās. Maģistra darbā analizēta jēdziena „krāpniecisks darījums” izpratne krimināltiesībās un administratīvajās tiesībās, kā arī krāpnieciska darījuma konstatēšanas īpatnības minētajās tiesību nozarēs. Darbs sastāv no diviem izpētes blokiem, proti, krāpnieciska darījuma konstatēšanas īpatnību analīzes krimināltiesībās un šāda darījuma konstatēšanas īpatnību analīzes administratīvajās tiesībās. Pētījuma rezultātā darba autore konstatēja, ka ir vērojamas būtiskas atšķirības krāpniecisko darījumu konstatēšanā administratīvajās tiesībās un krimināltiesībās. Pētījuma rezultāti iezīmē jēdziena „krāpni…

fiskālo priekšrocību gūšanašķietams darījumskrāpniecisks darījumsneesošs darījumsfiktīvs darījumsJuridiskā zinātne
researchProduct