Search results for "EIL"

showing 10 items of 2499 documents

Subtype-specific incidence of testicular cancer in Germany: a pooled analysis of nine population-based cancer registries.

2009

Summary Comparisons of incidence estimates of testicular cancer subtypes beyond seminoma and non-seminoma are virtually missing in the epidemiologic literature. We analysed incidence data from population-based German cancer registries to provide subtype-specific incidences of testicular cancer. We pooled data from nine cancer registries from 1998 to 2003. We estimated incidence and mortality time trends of West and East Germany. Incidence and mortality were standardized by the European standard population. The annual percentage incidence change from 1961 through 1989 was 4.9% in East Germany and 3.0% from 1970 through 2004 in Saarland. Incidence increases were the most pronounced among adol…

AdultMalemedicine.medical_specialtyTime Factorsendocrine system diseasesAdolescentUrologyEndocrinology Diabetes and MetabolismPopulationPopulation basedEmbryonal carcinomaYoung AdultAge DistributionTesticular NeoplasmsCarcinoma EmbryonalGermanymedicineHumansChoriocarcinomaRegistrieseducationChildTesticular cancerAgedGynecologyAged 80 and overeducation.field_of_studybusiness.industryIncidence (epidemiology)IncidenceInfant NewbornTeratomaCancerInfantSeminomaMiddle Agedmedicine.diseaseSeminomaReproductive MedicineTesticular LymphomaChild PreschoolPopulation SurveillancebusinessDemographyInternational journal of andrology
researchProduct

Invasive fungal disease in patients undergoing umbilical cord blood transplantation after myeloablative conditioning regimen

2018

OBJECTIVE Characteristics and risk factors (RFs) of invasive fungal disease (IFD) have been little studied in the setting of umbilical cord blood transplantation (UCBT). METHOD We retrospectively included 205 single-unit myeloablative UCBT recipients with a median follow-up of 64 months. RESULTS Fifty-six episodes of IFD were observed in 48 patients (23%) at a median time of 123 days after stem cell infusion. Invasive mold disease (IMD) occurred in 42 cases, 38 of them (90%) caused by invasive aspergillosis whereas invasive yeast disease (IYD) occurred in 14 cases, most of them due to candidemia (n = 12, 86%). The 5-year cumulative incidence of IFD, IMDs, and IYDs was 24% 19%, and 7%, respe…

AdultMalemedicine.medical_specialtyTransplantation ConditioningMultivariate analysisAdolescentGraft vs Host DiseaseDiseaseAspergillosisSeverity of Illness IndexGastroenterologyYoung Adult03 medical and health sciences0302 clinical medicineAnti-Infective AgentsRisk FactorsCause of DeathInternal medicinemedicineHumansPublic Health SurveillanceCumulative incidenceRetrospective Studiesbusiness.industryUmbilical Cord Blood TransplantationIncidenceHematologyGeneral MedicineMiddle Agedmedicine.diseasePatient Outcome AssessmentGraft-versus-host diseaseMycoses030220 oncology & carcinogenesisFemaleCord Blood Stem Cell TransplantationStem cellComplicationbusiness030215 immunologyEuropean Journal of Haematology
researchProduct

High-density electromyography activity in various hamstring exercises

2019

Proximal-distal differences in muscle activity are rarely considered when defining the activity level of hamstring muscles. The aim of this study was to determine the inter-muscular and proximal-distal electromyography (EMG) activity patterns of hamstring muscles during common hamstring exercises. Nineteen amateur athletes without a history of hamstring injury performed 9 exercises, while EMG activity was recorded along the biceps femoris long head (BFlh) and semitendinosus (ST) muscles using 15-channel high-density electromyography (HD-EMG) electrodes. EMG activity levels normalized to those of a maximal voluntary isometric contraction (%MVIC) were determined for the eccentric and concentr…

AdultMalemedicine.medical_specialtyharjoitteetinjury reductionHamstring MusclesPhysical Therapy Sports Therapy and RehabilitationIsometric exerciseElectromyography030204 cardiovascular system & hematologyConcentricBicepsrehabilitationRC1200Young Adult03 medical and health sciences0302 clinical medicinePhysical medicine and rehabilitationIsometric ContractionHumansMedicineEccentricKneeOrthopedics and Sports Medicineheterogeneous activityRange of Motion ArticularLeg curlta315ExerciseHamstring injuryurheiluvammatHipmedicine.diagnostic_testGV557_SportslihasaktiivisuusElectromyographybusiness.industryreidet030229 sport sciencesmedicine.diseaseHamstring exerciseselektromyografiaTorqueAthleteskuntoutusbusinessScandinavian Journal of Medicine and Science in Sports
researchProduct

Use of Visual Feedback During Jump-Squat Training Aids Improvement in Sport-Specific Tests in Athletes.

2020

Vanderka, M, Bezak, A, Longova, K, Krcmar, M, and Walker, S. Use of visual feedback during jump-squat training aids improvement in sport-specific tests in athletes. J Strength Cond Res 34(8): 2250-2257, 2020-This study investigated the effects of instantaneous performance feedback during the jump-squat exercise over a 6-week training period. Twenty-five strength-trained athletes were randomly divided into an instant feedback (n = 13, half-squat 3-repetition maximum (3RM)/body mass = 2.38 ± 0.19) or a nonfeedback (n = 12, half-squat 3RM/body mass = 2.03 ± 0.44) group. Both groups performed the same training program (3 × week), consisting of 4 sets of 8 repetitions (weeks 1-3) and 8 sets of 4…

AdultMalemedicine.medical_specialtyjump-squat trainingPosturetestitPhysical Therapy Sports Therapy and RehabilitationSquatVisual feedback030204 cardiovascular system & hematologyConcentricRunning03 medical and health sciencesYoung Adult0302 clinical medicinePhysical medicine and rehabilitationSquat jumpFeedback SensorymedicineharjoitteluHumansOrthopedics and Sports MedicineMuscle StrengthLead (electronics)Mathematicssuorituskykyvisual feedbackbiologyAthletespalauteTraining (meteorology)Resistance Training030229 sport sciencesGeneral Medicinebiology.organism_classificationAdaptation PhysiologicalAthletesJumpvoimaharjoitteluurheilijatJournal of strength and conditioning research
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Defining a reference population to determine the 99th percentile of a contemporary sensitive cardiac troponin I assay

2013

Abstract Background Diagnosis of acute myocardial infarction (AMI) according to the universal definition is based on ischemic symptoms, imaging findings and elevated myocardial necrosis markers, preferably cardiac troponin I/T with diagnostic threshold representing the 99th percentile of a reference population. It is not clearly defined if this should be an unselected population-based or a healthy cohort with respect to cardiac diseases. Aim of the current study was to describe the distribution of troponin I using a sensitive assay and to evaluate the impact of cardiac diseases and cardiovascular risk factors in apparently healthy individuals. Methods Troponin I was determined using a conte…

AdultMalemedicine.medical_specialtymedicine.drug_classPopulationDiseaseCohort StudiesSex FactorsReference ValuesRisk FactorsInternal medicineTroponin INatriuretic peptidemedicineHumansProspective StudiesMyocardial infarctioneducationAgededucation.field_of_studybusiness.industryTroponin IAge FactorsMiddle Agedmedicine.diseaseSurgeryCross-Sectional StudiesCardiovascular DiseasesPopulation SurveillanceCohortCardiologyPopulation studyFemaleCardiology and Cardiovascular MedicinebusinessBiomarkersCohort studyInternational Journal of Cardiology
researchProduct

Primary HBB gene mutation severity and long-term outcomes in a global cohort of β-thalassaemia

2021

In β-thalassaemia, the severity of inherited β-globin gene mutations determines the severity of the clinical phenotype at presentation and subsequent transfusion requirements. However, data on associated long-term outcomes remain limited. We analysed data from 2109 β-thalassaemia patients with available genotypes in a global database. Genotype severity was grouped as β0 /β0 , β0 /β+ , β+ /β+ , β0 /β++ , β+ /β++ , and β++ /β++ . Patients were followed from birth until death or loss to follow-up. The median follow-up time was 34·1 years. Mortality and multiple morbidity outcomes were analyzed through five different stratification models of genotype severity groups. Interestingly, β0 and β+ mu…

AdultMalemedicine.medical_specialtyphenotypegenotypemorbidityKaplan-Meier Estimatebeta-GlobinsGene mutationβ thalassaemiaGlobal HealthGastroenterologySeverity of Illness IndexsurvivalCohort StudiesYoung AdultInternal medicineGenotypemedicineLong term outcomesOdds RatioHumansAllelesgenotype; morbidity; mortality; phenotype; survivalProportional Hazards Modelsbusiness.industrybeta-ThalassemiaDisease ManagementHematologyPrognosisPhenotypemortalityConfidence intervalPopulation SurveillanceCohortMutationFemaleRisk of deathbusinessFollow-Up Studies
researchProduct

Running in highly cushioned shoes increases leg stiffness and amplifies impact loading

2018

AbstractRunning shoe cushioning has become a standard method for managing impact loading and consequent injuries due to running. However, despite decades of shoe technology developments and the fact that shoes have become increasingly cushioned, aimed to ease the impact on runners’ legs, running injuries have not decreased. To better understand the shoe cushioning paradox, we examined impact loading and the spring-like mechanics of running in a conventional control running shoe and a highly cushioned maximalist shoe at two training speeds, 10 and 14.5 km/h. We found that highly cushioned maximalist shoes alter spring-like running mechanics and amplify rather than attenuate impact loading. T…

AdultMalemusculoskeletal diseasesrasitusvammatComputer sciencelcsh:MedicineHEEL STRIKEMASSbone quality and biomechanicsurheilujalkineetArticlejuoksuGROUND REACTION FORCES03 medical and health sciences0302 clinical medicineotorhinolaryngologic diseasesHumans315 Sport and fitness sciencesGround reaction forcelcsh:ScienceHeel strikeWORKLeg stiffnessLegMultidisciplinaryRunning injuriesbusiness.industryWork (physics)lcsh:Rtechnology industry and agricultureCushioning030229 sport sciencesStructural engineeringShoesbody regionsMECHANICSRUNNERSImpact loadingLoading rateINJURIESlcsh:Qbiomekaniikkabusiness030217 neurology & neurosurgeryScientific Reports
researchProduct

Arousal/Stress Effects of “Overwatch” eSports Game Competition in Collegiate Gamers

2022

Kraemer, WJ, Caldwell, LK, Post, EM, Beeler, MK, Emerson, A, Volek, JS, Maresh, CM, Fogt, JS, Fogt, N, Häkkinen, K, Newton, RU, Lopez, P, Sanchez, BN, and Onate, JA. Arousal/stress effects of “Overwatch” eSports game competition in collegiate gamers. J Strength Cond Res XX(X): 000–000, 2022—To date, no physical response data are available for one of the most popular eSport games, Overwatch. The purpose of this investigation was to describe the stress signaling associated with competitive Overwatch play and to understand how acute hormonal responses may affect performance. Thirty-two male college-aged gamers (age: 21.3 ± 2.7 years; estimated time played per week: 18 ± 15 hours) completed the…

AdultMalesykeendocrineAdolescentHydrocortisoneUniversitieselektroninen urheiluPhysical Therapy Sports Therapy and RehabilitationcortisolYoung Adulthydrokortisonipelaajatheart rateHumansTestosteroneOrthopedics and Sports Medicinesuorituskykysydänvideo gamesGeneral MedicinestressihormonittestosteronetestosteroniArousal
researchProduct

A study protocol for applying the co-creating knowledge translation framework to a population health study

2013

Background: Population health research can generate significant outcomes for communities, while Knowledge Translation (KT) aims to expressly maximize the outcomes of knowledge producing activity. Yet the two approaches are seldom explicitly combined as part of the research process. A population health study in Port Lincoln, South Australia offered the opportunity to develop and apply the co-KT Framework to the entire research process. This is a new framework to facilitate knowledge formation collaboratively between researchers and communities throughout a research to intervention implementation process. Design: This study employs a five step framework (the co-KT Framework) that is formulate…

AdultRural PopulationKnowledge managementAdolescentParticipatory action researchHealth InformaticsKnowledge frameworkKnowledge creationKnowledge translationTranslational Research BiomedicalStudy ProtocolYoung Adult03 medical and health sciences0302 clinical medicineNursingKnowledge translationSouth AustraliaHumansMedicine030212 general & internal medicineAction researchChildHealth policyAgedMedicine(all)business.industry030503 health policy & servicesHealth PolicyPopulation healthPublic Health Environmental and Occupational HealthHealth services researchInfantGeneral MedicineMiddle AgedKnowledge baseResearch DesignChild PreschoolPopulation SurveillanceCommunity healthKnowledge translation modelCommunity health0305 other medical sciencebusinessAction researchEngaged scholarshipImplementation Science
researchProduct