Search results for "EPILEPSY"

showing 10 items of 420 documents

Endoscopic and endoscope-assisted neurosurgical treatment of suprasellar arachnoidal cysts (Mickey Mouse cysts).

2005

Suprasellar arachnoid cysts represent less than 10% of all intracranial arachnoid cysts. Some of them may be quiescent throughout life, some may become symptomatic as they become enlarged and some disappear spontaneously. In this study we discuss the surgical strategies for endoscopic and endoscope-assisted treatment of suprasellar (Mickey Mouse) cysts and analyze the clinical results and experience collected over some years in our department upon doing these operations routinely. Between December 1996 and December 2003, 13 patients (7 female and 6 male patients), mean age 29 years, underwent endoscopic or endoscope-assisted procedures for suprasellar cysts at our department. The indication…

AdultMalemedicine.medical_specialtyEndoscopeAdolescentNeurosurgical ProceduresEpilepsyPostoperative ComplicationsMedicineHumansMinimally Invasive Surgical ProceduresCystChildCerebrospinal Fluidmedicine.diagnostic_testbusiness.industryMagnetic resonance imagingGeneral MedicineMiddle Agedmedicine.diseaseMagnetic Resonance ImagingCerebrospinal Fluid ShuntsSurgeryEndoscopyShunt (medical)Arachnoid CystsNeuroendoscopymedicine.anatomical_structureTreatment OutcomeChild PreschoolNeuroendoscopySurgeryNeurology (clinical)Subarachnoid spacebusinessMinimally invasive neurosurgery : MIN
researchProduct

Oxidative stress markers in the neocortex of drug-resistant epilepsy patients submitted to epilepsy surgery

2013

Summary Purpose While there is solid experimental evidence of brain oxidative stress in animal models of epilepsy, it has not been thoroughly verified in epileptic human brain. Our purpose was to determine and to compare oxidative stress markers in the neocortex of epileptic and non-epileptic humans, with the final objective of confirming oxidative stress phenomena in human epileptic brain. Methods Neocortical samples from drug-resistant epilepsy patients submitted to epilepsy surgery ( n =20) and from control, non-epileptic cortex samples ( n =11) obtained from brain bank donors without neurological disease, were studied for oxidative stress markers: levels of reactive oxygen species (ROS)…

AdultMalemedicine.medical_specialtyGlutathione reductaseNeocortexBiologymedicine.disease_causeLipid peroxidationSuperoxide dismutasechemistry.chemical_compoundEpilepsyInternal medicinemedicineHumansTreatment Failurechemistry.chemical_classificationGlutathione PeroxidaseReactive oxygen speciesEpilepsySuperoxide DismutaseGlutathione peroxidaseMiddle AgedCatalasemedicine.diseasePsychosurgeryOxidative StressGlutathione ReductaseEndocrinologyNeurologyBiochemistrychemistryCatalaseRetreatmentbiology.proteinAnticonvulsantsFemaleNeurology (clinical)BiomarkersOxidative stressEpilepsy Research
researchProduct

Drug-induced pertubation of the aminothiol redox-status in patients with epilepsy: improvement by B-vitamins.

2008

Summary Objectives Patients with epilepsy have excess morbidity and mortality due to ischemic cardiovascular disease. Many of these patients have elevated concentrations of plasma total homocysteine (Hcy), which is an acknowledged risk factor for cardiovascular disease, venous thromboembolic disease, foetal malformations and dementia. Hyperhomocysteinemia may have negative effects through mechanisms involving oxidative damage. In the present study, we have investigated the aminothiol redox-status in patients on antiepileptic drugs. Thereafter, in a subset of patients with elevated total Hcy, we evaluated the effect of B-vitamin therapy. Methods In the first part of the study, 101 patients o…

AdultMalemedicine.medical_specialtyHyperhomocysteinemiaHomocysteinemedicine.medical_treatmentRiboflavinHyperhomocysteinemiaRiboflavinchemistry.chemical_compoundFolic AcidMethionineVitamin B DeficiencyInternal medicinemedicineHumansCysteineMethionineEpilepsybusiness.industryValproic AcidCase-control studyPyridoxineDipeptidesmedicine.diseasePyridoxineSurgeryB vitaminsEndocrinologyAnticonvulsantCarbamazepineNeurologychemistryLiverCase-Control StudiesPhenobarbitalPhenytoinDrug EvaluationAnticonvulsantsFemaleNeurology (clinical)businessOxidation-ReductionPrimidonemedicine.drugEpilepsy research
researchProduct

Headache in epilepsy: prevalence and clinical features

2015

Background Headache and epilepsy are two relatively common neurological disorders and their relationship is still a matter of debate. Our aim was to estimate the prevalence and clinical features of inter-ictal (inter-IH) and peri-ictal headache (peri-IH) in patients with epilepsy. Methods All patients aged ≥ 17 years referring to our tertiary Epilepsy Centre were consecutively recruited from March to May 2011 and from March to July 2012. They underwent a semi-structured interview including the International Classification Headache Disorders (ICHD-II) criteria to diagnose the lifetime occurrence of headache.χ2-test, t-test and Mann–Whitney test were used to compare clinical variables in pati…

AdultMalemedicine.medical_specialtyNeurologyAdolescentCross-sectional studyClinical NeurologyPost-ictal headacheEpilepsyYoung AdultPrimary headacheInternal medicinePrevalenceMedicineHumansIn patientYoung adultStrokeMigraineAgedAged 80 and overPre-ictal headacheEpilepsybusiness.industryHeadacheGeneral MedicineMiddle Agedmedicine.diseaseclinical featurenervous system diseasesStrokeAnesthesiology and Pain MedicineCross-Sectional Studiesnervous systemMigraineAnesthesiaFemaleNeurology (clinical)businessResearch ArticleThe Journal of Headache and Pain
researchProduct

Relation between Sexual Dysfunctions and Epilepsy, Type of Epilepsy, Type of Antiepileptic Drugs: A Prospective Study

2017

Introduction The aim of this study was to evaluate the incidence of sexual dysfunctions in males with epilepsy, the type of epilepsy, the frequency of seizures, the type of antiepileptic drugs (AEDs), the serum hormonal profile and the presence of psychiatric comorbidity. Methods Sixty-one patients focused on type of epilepsy, frequency of seizures, AEDs, hormonal profile and presence of mood disorders. We excluded all patients with severe neurologic and psychiatric impairment and patient who were not able to fill questionnaires. Mean age was 31.2 years (range 18-50 years); 31 patients (50.8%) had an idiopathic generalised epilepsy and 30 (49.2%) a focal epilepsy; among them, latter 18 (60%…

AdultMalemedicine.medical_specialtyPediatricsAdolescentSexual dysfunctionSettore MED/24 - UrologiaYoung Adult03 medical and health sciencesEpilepsyTestosterone blood0302 clinical medicinemedicineHumansTestosteroneSex hormonesProspective StudiesSexual Dysfunctions PsychologicalYoung adultProspective cohort studyPsychiatryEpilepsybusiness.industryIncidenceIncidence (epidemiology)Testosterone (patch)General MedicineCarbamazepineMiddle Agedmedicine.disease030227 psychiatrySexual Dysfunction PhysiologicalCarbamazepineSexual dysfunctionAnticonvulsantsSettore MED/26 - Neurologiamedicine.symptombusiness030217 neurology & neurosurgerymedicine.drugUrologia Journal
researchProduct

Mortality in the first 30 days following incident acute symptomatic seizures.

2005

Purpose: Very little is known about short-term mortality after acute symptomatic seizure. One study found an increased mortality in the first year after acute symptomatic seizure, like mortality following acute symptomatic status epilepticus. Methods: We studied mortality in the first 30 days after an acute symptomatic seizure in two cohorts. In Washington Heights, New York City, we reviewed the medical records of all adults aged 20 years and older seen at Columbia Presbyterian Medical Center from January 1, 1990 through December 13, 1994 to identify incident acute symptomatic seizure. In Rochester, Minnesota, the medical records of all Rochester residents were reviewed to identify incident…

AdultMalemedicine.medical_specialtyPediatricsMinnesotaComorbidityCohort StudiesEpilepsyCause of DeathCase fatality ratemedicineHumansMortalityCause of deathAgedEpilepsybusiness.industryIncidence (epidemiology)IncidenceSymptomatic seizuresMiddle Agedmedicine.diseaseSurgeryStandardized mortality ratioNeurologyAcute DiseaseEtiologyFemaleNew York CityNeurology (clinical)businessCohort studyFollow-Up StudiesEpilepsia
researchProduct

Prevalence of epilepsy. A door-to-door survey in the Sicilian community of Riposto.

1996

In a door-to-door survey of common neurological disorders in Sicily (SNES Project), we administered a screening symptoms questionnaire and a brief neurological examination to detect epileptic patients. All of the subjects effectively resident in the community of Riposto on 1 November 1987 (prevalence day) were investigated (n = 9956). The subjects with a positive questionnaire or a previous diagnosis of epilepsy were extensively examined by a neurologist and then definitively classified for epilepsy by a panel of senior neurologists. The crude prevalence of active and non-active epilepsy was 3.21/1000; the prevalence of active epilepsy alone was 2.71/1000. Of the 27 active cases, sixteen we…

AdultMalemedicine.medical_specialtyPediatricsNeurologyAdolescentPrevalenceNeurological examinationEpilepsyEpidemiologymedicinePrevalenceHumansAge of OnsetChildEpilepsymedicine.diagnostic_testbusiness.industryGeneral NeuroscienceMiddle Agedmedicine.diseaseItalyPhenobarbitalFemaleNeurology (clinical)NeurosurgeryAge of onsetbusinessmedicine.drugItalian journal of neurological sciences
researchProduct

Are negative mood states associated with cognitive function in newly diagnosed patients with epilepsy?

2000

Summary: Purpose: The association of self-reported subclinical depressive symptoms and negative mood states with cognitive functioning was evaluated in 51 consecutive newly diagnosed adult persons with epilepsy. Methods: Emotional state was assessed with Profile of Mood States (POMS) and Brief Depression Scale (BDS) and was correlated with a battery of neuropsychological tests. Results: Patients with epilepsy reported more depressive symptoms in BDS than in controls. They also had more feeling of bewilderment and less vigor on POMS. Higher scores in BDS and in POMS inefficiency scale were associated with slower nondominant hand tapping, but emotional state did not correlate with cognitive m…

AdultMalemedicine.medical_specialtyPsychometricsPersonality InventoryComorbidityNeuropsychological TestsProfile of mood states050105 experimental psychology03 medical and health sciencesEpilepsy0302 clinical medicinemedicineHumans0501 psychology and cognitive sciencesPsychiatryDepression (differential diagnoses)FinlandPsychiatric Status Rating ScalesDepressive DisorderEpilepsyMood Disorders05 social sciencesNeuropsychologyCognitionmedicine.diseaseComorbidityNeurologyFemaleNeurology (clinical)Personality Assessment InventoryPsychologyCognition DisordersAttitude to Health030217 neurology & neurosurgeryPsychomotor PerformanceEpilepsia
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Insight into epileptic and physiological déjà vu: from a multicentric cohort study

2019

Background and purpose The presence of a continuum between physiological deja vu (DV) and epileptic DV is still not known as well as epidemiological data in the Italian population. The aim was to identify the epidemiological distribution of DV in Italy, and secondly to look for specific features of DV able to discriminate between epileptic and non-epileptic DV. Methods In all, 1000 individuals, 543 healthy controls (C) (313 women; age 40 ± 15 years) and 457 patients with epilepsy (E) (260 women; age 39 ± 14 years), were prospectively recruited from 10 outpatient neurological clinics throughout Italy. All populations were screened using the Italian Inventory for Deja Vu Experiences Assessmen…

AdultMalemedicine.medical_specialtymedia_common.quotation_subjectNeurocognitive Disordersepilepsy; epileptic déjà vu; physiological déjà vu; Adult; Cohort Studies; Epilepsy; Female; Humans; Italy; Male; Middle Aged; Neurocognitive Disorders; Recognition Psychology; Deja VuCohort Studies03 medical and health sciencesEpilepsy0302 clinical medicineEpidemiologyHumansPsychologyMedicine030212 general & internal medicinePsychiatrymedia_commonbusiness.industryphysiological déjà vuRecognition PsychologyMiddle AgedDeja Vumedicine.diseaseItalian populationepileptic déjà vuRecognitionItalyNeurologyFeelingDéjà vuEtiologyepilepsyFemaleNeurology (clinical)Epileptic seizuremedicine.symptombusiness030217 neurology & neurosurgeryCohort study
researchProduct