Search results for "ESA"

showing 10 items of 11914 documents

Discrete spectral incoherent solitons in nonlinear media with noninstantaneous response

2011

International audience; We show theoretically that nonlinear optical media characterized by a finite response time may support the existence of discrete spectral incoherent solitons. The structure of the soliton consists of three incoherent spectral bands that propagate in frequency space toward the low-frequency components in a discrete fashion and with a constant velocity. Discrete spectral incoherent solitons do not exhibit a confinement in the space-time domain, but exclusively in the frequency domain. The kinetic theory describes in detail all the essential properties of discrete spectral incoherent solitons: A quantitative agreement has been obtained between simulations of the kinetic…

01 natural sciencesoptical instabilitiesSchrödinger equation010309 opticssymbols.namesakeand lossesQuantum mechanics0103 physical sciencesDispersion (optics)Dynamics of nonlinear optical systemsOptical solitonssolitons010306 general physicsPropagationNonlinear Schrödinger equationNonlinear Sciences::Pattern Formation and SolitonsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]and optical spatio-temporal dynamicsscatteringWave equationAtomic and Molecular Physics and OpticsSupercontinuumNonlinear systemFrequency domainsymbolsoptical chaos and complexitySolitonnonlinear guided waves
researchProduct

Random Tensor Theory: Extending Random Matrix Theory to Mixtures of Random Product States

2012

We consider a problem in random matrix theory that is inspired by quantum information theory: determining the largest eigenvalue of a sum of p random product states in $${(\mathbb {C}^d)^{\otimes k}}$$ , where k and p/d k are fixed while d → ∞. When k = 1, the Marcenko-Pastur law determines (up to small corrections) not only the largest eigenvalue ( $${(1+\sqrt{p/d^k})^2}$$ ) but the smallest eigenvalue $${(\min(0,1-\sqrt{p/d^k})^2)}$$ and the spectral density in between. We use the method of moments to show that for k > 1 the largest eigenvalue is still approximately $${(1+\sqrt{p/d^k})^2}$$ and the spectral density approaches that of the Marcenko-Pastur law, generalizing the random matrix…

010102 general mathematicsSpectral densityStatistical and Nonlinear PhysicsMethod of moments (probability theory)01 natural sciencesCombinatorics010104 statistics & probabilitysymbols.namesakeDistribution (mathematics)Product (mathematics)Gaussian integralsymbolsTensor0101 mathematicsRandom matrixMathematical PhysicsEigenvalues and eigenvectorsMathematicsCommunications in Mathematical Physics
researchProduct

Restricted compositions and permutations: from old to new Gray codes

2011

Any Gray code for a set of combinatorial objects defines a total order relation on this set: x is less than y if and only if y occurs after x in the Gray code list. Let @? denote the order relation induced by the classical Gray code for the product set (the natural extension of the Binary Reflected Gray Code to k-ary tuples). The restriction of @? to the set of compositions and bounded compositions gives known Gray codes for those sets. Here we show that @? restricted to the set of bounded compositions of an interval yields still a Gray code. An n-composition of an interval is an n-tuple of integers whose sum lies between two integers; and the set of bounded n-compositions of an interval si…

0102 computer and information sciences02 engineering and technologyInterval (mathematics)[ MATH.MATH-CO ] Mathematics [math]/Combinatorics [math.CO]01 natural sciencesTheoretical Computer ScienceCombinatoricsGray codePermutationsymbols.namesakeInteger020204 information systems[MATH.MATH-CO]Mathematics [math]/Combinatorics [math.CO]0202 electrical engineering electronic engineering information engineeringComputingMilieux_MISCELLANEOUSMathematicsDiscrete mathematicsExtension (predicate logic)Composition (combinatorics)Cartesian productComputer Science Applications010201 computation theory & mathematicsComputer Science::Computer Vision and Pattern RecognitionBounded functionSignal ProcessingsymbolsInformation Systems
researchProduct

Plastic yielding of glass in high-pressure torsion apparatus

2018

International audience; Hardness measurements performed at room temperature have demonstrated that glass can flow under elevated pressure, whereas the effect of high pressure on glass rheology remains poorly quantified. Here, we applied a high-pressure torsion (HPT) apparatus to deform SCHOTT SF6 â glass and attempted to quantify the effect of pressure and temperature on the shear deformation of glass subjected to pressures from 0.3 GPa to 7 GPa and temperatures from 25 ℃ to 496 ℃. Results show that the plastic yield deformation was occurring during the HPT experiments on the SF6 glass at elevated temperature from 350 ℃ to 496 ℃. The yield stress of SF6 glass decreases with increasing tempe…

010302 applied physicsArrhenius equationPlastic yieldingMaterials scienceYield (engineering)Deformation (mechanics)Plastic yieldingTorsion (mechanics)02 engineering and technologyActivation energy[SPI.MAT] Engineering Sciences [physics]/Materials021001 nanoscience & nanotechnology01 natural sciencesglass flow[SPI.MAT]Engineering Sciences [physics]/Materialspressuresymbols.namesakehigh-pressure torsionRheologyHigh pressure0103 physical sciencessymbolsGeneral Materials ScienceComposite material0210 nano-technologyInternational Journal of Applied Glass Science
researchProduct

Pressure-induced instability of the fergusonite phase of EuNbO4 studied by in situ Raman spectroscopy, x-ray diffraction, and photoluminescence spect…

2020

In this article, we present high-pressure experimental investigations on EuNbO4, an interesting technologically important material, using synchrotron based x-ray powder diffraction, Raman spectroscopy, and europium photoluminescence measurements up to 39.2, 31.6, and 32.4 GPa, respectively. All three techniques show the stability of the ambient monoclinic phase until 20 GPa. Beyond that, a pressure-induced structural phase transition takes place with the coexistence of two phases over a wide pressure range. The structure of the high-pressure phase has been determined as orthorhombic (space group: Imma) with a volume discontinuity of nearly 9% at the transition indicating the nature of trans…

010302 applied physicsBulk modulusMaterials scienceAnalytical chemistryGeneral Physics and Astronomychemistry.chemical_element02 engineering and technology021001 nanoscience & nanotechnologyFergusonite01 natural sciencessymbols.namesakechemistry0103 physical sciencessymbolsOrthorhombic crystal system0210 nano-technologySpectroscopyEuropiumRaman spectroscopyPowder diffractionMonoclinic crystal systemJournal of Applied Physics
researchProduct

Irradiation effects in CaF2probed by Raman scattering

2016

The formation conditions and dynamics of Ca colloids and point defects that appear in irradiated single crystals of CaF2 were investigated by Raman spectroscopy. The intensity changes in the Raman spectra because of the presence of different concentrations of point defects and Ca colloids that emerged in CaF2 after irradiation with 2.2 GeV Au ions were used to study their distribution and stability under illumination with three laser wavelengths (473, 532 and 633 nm) at different output powers (2 to 200 mW). A damage saturation at a fluence of 6 × 1011 ion cm−2 was observed. The dependence of the spectral changes on the ion fluence can be described by a core/halo damage cross-section model.…

010302 applied physicsChemistryAnalytical chemistry02 engineering and technology021001 nanoscience & nanotechnologyLaser01 natural sciencesCrystallographic defectMolecular physicsFluencelaw.inventionIonsymbols.namesakeSwift heavy ionlaw0103 physical sciencessymbolsGeneral Materials ScienceIrradiation0210 nano-technologyRaman spectroscopySpectroscopyRaman scatteringJournal of Raman Spectroscopy
researchProduct

Analytical description of solid particles kinematics due to a fluid flow and application to the depiction of characteristic kinematics in cold sprayi…

2017

Abstract In several multiphase flow applications such as fluidization, thermal spraying, atomization manufacturing and so on, the Newton's law is widely enacted to formulate the particle/fluid kinematic interaction and then to compute particles kinematics. This paper provides analytical solutions of the Newton's law in its time-dependent formulation or simplified formulation, the latter being a reduction of the time dependent problem into a spatial description of the particle motion. It was found that the velocity solution is strictly similar in both cases so that the simplified formulation is viable. The W_ 1 branch of the Lambert's function yields the analytical particle residence time an…

010302 applied physicsChemistryGeneral Chemical EngineeringMultiphase flow02 engineering and technologyMechanicsKinematics021001 nanoscience & nanotechnologyResidence time (fluid dynamics)01 natural sciencessymbols.namesakeMach number0103 physical sciencesFluid dynamicssymbolsParticleParticle velocity0210 nano-technologyMagnetosphere particle motionPowder Technology
researchProduct

Amorphous ultra-wide bandgap ZnOx thin films deposited at cryogenic temperatures

2020

Crystalline wurtzite zinc oxide (w-ZnO) can be used as a wide band gap semiconductor for light emitting devices and for transparent or high temperature electronics. The use of amorphous zinc oxide (a-ZnO) can be an advantage in these applications. In this paper we report on X-ray amorphous a-ZnOx thin films (~500 nm) deposited at cryogenic temperatures by reactive magnetron sputtering. The substrates were cooled by a nitrogen flow through the copper substrate holder during the deposition. The films were characterized by X-ray diffraction (XRD), Raman, infrared, UV-Vis-NIR spectroscopies, and ellipsometry. The a-ZnOx films on glass and Ti substrates were obtained at the substrate holder temp…

010302 applied physicsCondensed Matter - Materials ScienceMaterials sciencebusiness.industryBand gapGeneral Physics and AstronomyMaterials Science (cond-mat.mtrl-sci)FOS: Physical sciences02 engineering and technologySubstrate (electronics)021001 nanoscience & nanotechnology01 natural sciencesAmorphous solidsymbols.namesakeSputteringEllipsometry0103 physical sciencessymbolsOptoelectronicsFourier transform infrared spectroscopyThin film0210 nano-technologybusinessRaman spectroscopy
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

X-ray diffraction and Raman spectroscopy studies in Na1/2Bi1/2TiO3-SrTiO3-PbTiO3 solid solutions

2016

The long and short range orders in 0.4Na1/2Bi1/2TiO3-(0.6-x)SrTiO3-xPbTiO3 solid solutions were studied by x-ray diffraction and Raman spectroscopy. X-ray diffraction patterns for these composition...

010302 applied physicsDiffractionMaterials scienceAnalytical chemistry02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic Materialssymbols.namesakeNuclear magnetic resonance0103 physical sciencesX-ray crystallographysymbols0210 nano-technologyRaman spectroscopySolid solutionFerroelectrics
researchProduct