Search results for "FINE"

showing 10 items of 1800 documents

Sobolev and bounded variation functions on metric measure spaces

2014

International audience

[ MATH ] Mathematics [math]DifferentiabilityEquationsSets010102 general mathematicsTransport[MATH] Mathematics [math]01 natural sciencesDerivationsFine PropertiesFinite Perimeter010104 statistics & probabilityRicci Curvature BoundsLipschitz Functions0101 mathematics[MATH]Mathematics [math]InequalitiesComputingMilieux_MISCELLANEOUS
researchProduct

Categorical action of the extended braid group of affine type $A$

2017

Using a quiver algebra of a cyclic quiver, we construct a faithful categorical action of the extended braid group of affine type A on its bounded homotopy category of finitely generated projective modules. The algebra is trigraded and we identify the trigraded dimensions of the space of morphisms of this category with intersection numbers coming from the topological origin of the group.

[ MATH ] Mathematics [math]Pure mathematicsGeneral MathematicsCategorificationBraid groupGeometric intersection01 natural sciencesMathematics - Geometric TopologyMorphismMathematics::Category TheoryQuiverMathematics - Quantum Algebra0103 physical sciencesFOS: MathematicsQuantum Algebra (math.QA)Representation Theory (math.RT)0101 mathematics[MATH]Mathematics [math]MathematicsHomotopy categoryGroup (mathematics)Applied Mathematics010102 general mathematicsQuiverBraid groupsGeometric Topology (math.GT)16. Peace & justiceCategorificationCategorical actionBounded functionMSC: 20F36 18E30 57M99 13D99010307 mathematical physicsAffine transformationMathematics - Representation Theory
researchProduct

Asymptotics of accessibility sets along an abnormal trajectory

2001

We describe precisely, under generic conditions, the contact of the accessibility set at time $T$ with an abnormal direction, first for a single-input affine control system with constraint on the control, and then as an application for a sub-Riemannian system of rank 2. As a consequence we obtain in sub-Riemannian geometry a new splitting-up of the sphere near an abnormal minimizer $\gamma$ into two sectors, bordered by the first Pontryagin's cone along $\gamma$, called the $\xLinfty$-sector and the $\xLtwo$-sector. Moreover we find again necessary and sufficient conditions of optimality of an abnormal trajectory for such systems, for any optimization problem.

[ MATH.MATH-OC ] Mathematics [math]/Optimization and Control [math.OC]0209 industrial biotechnologyControl and OptimizationOptimization problemRank (linear algebra)02 engineering and technologycontrol-affine systems01 natural sciencesSet (abstract data type)020901 industrial engineering & automationFOS: Mathematicssingular trajectories0101 mathematicsMathematics - Optimization and ControlMathematics010102 general mathematicsMathematical analysisConstraint (information theory)Computational MathematicsCone (topology)Optimization and Control (math.OC)Control and Systems EngineeringControl systemTrajectoryAffine transformation[MATH.MATH-OC]Mathematics [math]/Optimization and Control [math.OC]
researchProduct

Computation of conjugate times in smooth optimal control: the COTCOT algorithm

2006

Conjugate point type second order optimality conditions for extremals associated to smooth Hamiltonians are evaluated by means of a new algorithm. Two kinds of standard control problems fit in this setting: the so-called regular ones, and the minimum time singular single-input affine systems. Conjugate point theory is recalled in these two cases, and two applications are presented: the minimum time control of the Kepler and Euler equations.

[ MATH.MATH-OC ] Mathematics [math]/Optimization and Control [math.OC]Differential equationComputation010102 general mathematics05 social sciences050301 education[MATH.MATH-OC] Mathematics [math]/Optimization and Control [math.OC]Optimal control01 natural sciencesEuler equationssymbols.namesakesymbolsOrder (group theory)Point (geometry)Affine transformation[MATH.MATH-OC]Mathematics [math]/Optimization and Control [math.OC]0101 mathematics0503 educationAlgorithmMathematicsConjugate
researchProduct

Hyperfine Paschen-Back regime realized in Rb nanocell

2012

A simple and efficient scheme based on one-dimensional nanometric thin cell filled with Rb and strong permanent ring magnets allowed direct observation of hyperfine Paschen-Back regime on D1 line in 0.5 - 0.7 T magnetic field. Experimental results are perfectly consistent with the theory. In particular, with sigma+ laser excitation, the slopes of B-field dependence of frequency shift for all the 10 individual transitions of 85,87Rb are the same and equal to 18.6 MHz/mT. Possible applications for magnetometry with submicron spatial resolution and tunable atomic frequency references are discussed.

[ PHYS.QPHY ] Physics [physics]/Quantum Physics [quant-ph]Atomic Physics (physics.atom-ph)MagnetometerFOS: Physical sciences01 natural sciencesPhysics - Atomic Physicslaw.invention010309 optics[PHYS.QPHY]Physics [physics]/Quantum Physics [quant-ph]law0103 physical sciencesOCIS codes: 020.1335 300.6360010306 general physicsHyperfine structure[PHYS.QPHY] Physics [physics]/Quantum Physics [quant-ph]Line (formation)PhysicsNanocellLaserRubidiumAtomic and Molecular Physics and OpticsMagnetic fieldnanocellMagnetHyperfineAtomic physicsPaschen-BackExcitation
researchProduct

An alternative space-time meshless method for solving transient heat transfer problems with high discontinuous moving sources

2016

International audience; The aim of this work is the development of a space-time diffuse approximation meshless method (DAM) to solve heat equations containing discontinuous sources. This work is devoted to transient heat transfer problems with static and moving heat sources applied on a metallic plate and whose power presents temporal discontinuities. The space-time DAM using classical weight function is convenient for continuous transient heat transfer. Nevertheless, for problems including discontinuities, some spurious oscillations for the temperature field occur. A new weight function, respecting the principle of causality, is used to eradicate the physically unexpected oscillations.

[ SPI.MECA.GEME ] Engineering Sciences [physics]/Mechanics [physics.med-ph]/Mechanical engineering [physics.class-ph]Work (thermodynamics)Weight functionField (physics)finite element method02 engineering and technologyClassification of discontinuitieselasto-dynamic problems01 natural sciences[SPI]Engineering Sciences [physics]0203 mechanical engineering[ SPI ] Engineering Sciences [physics]free galerkin methodrefinement0101 mathematicsconvectionMathematicsNumerical AnalysisSpace timeMechanicsCondensed Matter Physics[ SPI.MECA.THER ] Engineering Sciences [physics]/Mechanics [physics.med-ph]/Thermics [physics.class-ph][SPI.MECA.GEME]Engineering Sciences [physics]/Mechanics [physics.med-ph]/Mechanical engineering [physics.class-ph]Computer Science ApplicationsPower (physics)010101 applied mathematics020303 mechanical engineering & transportsClassical mechanicsMechanics of MaterialsModeling and Simulation[SPI.MECA.THER]Engineering Sciences [physics]/Mechanics [physics.med-ph]/Thermics [physics.class-ph]Heat equationDevelopment (differential geometry)
researchProduct

PROFILE REFINEMENT IN ONTOLOGY-BASED RECOMMANDER SYSTEMS FOR ECONOMICAL E-NEWS

2014

International audience; This paper is interested in a recommender system of economic news articles. More precisely, it focuses on automatic profile refinement of customers which is an important task over time by taken into account logs of the user concerning especially his/her actions, reading time, and domain specific knowledge. In our approach, ontologies are used to describe and automatically refine these profiles. This work focuses on one particular type of recommender systems which is content-based recommenders. The aim of these recommender systems is to build a user profile and to improve its precision over time. Several improvements that have been made to these recommender systems ov…

[INFO.INFO-AI] Computer Science [cs]/Artificial Intelligence [cs.AI]recommender system[ INFO.INFO-IR ] Computer Science [cs]/Information Retrieval [cs.IR]profile refinement[INFO.INFO-IR]Computer Science [cs]/Information Retrieval [cs.IR]Semantic web.[INFO.INFO-IR] Computer Science [cs]/Information Retrieval [cs.IR]e-newsontology[ INFO.INFO-AI ] Computer Science [cs]/Artificial Intelligence [cs.AI][INFO.INFO-AI]Computer Science [cs]/Artificial Intelligence [cs.AI]
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Theoretical principles of near-field optical microscopies and spectroscopies

2000

International audience; This paper deals with the principles of detection of optical signals near a surface in a manner permitting the mapping of the distribution of the fields close to various kinds of illuminated samples. We begin with a discussion of the main physical properties of the optical fields near a surface in the absence of any probe tip. This mainly concerns phenomena involving evanescent waves for which the local decay lengths are governed not only by the sizes but also by the intrinsic properties of the surface structures. The interpretation of the detection process is reviewed on the basis of a discussion about the possibility of establishing direct comparisons between exper…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]ELECTRODYNAMICSEvanescent wavePOLARIZATIONGeneral Physics and AstronomyNear and far field02 engineering and technology01 natural scienceslaw.inventionSCANNING TUNNELING MICROSCOPESINGLE MOLECULESsymbols.namesakeOpticslaw0103 physical sciencesSCATTERINGPhysical and Theoretical ChemistryFLUORESCENCE010306 general physicsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]SURFACE-STRUCTURESLocal density of statesLIGHT CONFINEMENT[ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]SELF-CONSISTENTbusiness.industryScattering021001 nanoscience & nanotechnologyPolarization (waves)Maxwell's equationsRESOLUTIONsymbolsNear-field scanning optical microscopeScanning tunneling microscope0210 nano-technologybusiness
researchProduct

Progress in the interpretation of near-field optics

1998

International audience

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]SURFACE-STRUCTURES[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]LIGHT CONFINEMENTSCATTERINGMICROSCOPYComputingMilieux_MISCELLANEOUSSCALE
researchProduct