Search results for "FONO"

showing 10 items of 230 documents

Un’isoglossa indoeuropea per mantis? in G. Rocca (a cura di), Dialetti, dialettismi, generi letterari e funzioni sociali. Atti del V Convegno Interna…

2004

L'articolo presenta la ricostruzione fonologica in diacronia degli esiti della sonante nasale indoeuropea nel greco antico. In particolare, attraverso un'analisi tipologico-comparativa, che pure attinge ai dati provenienti dalla ricerca archeologica, storica ed epigrafica, viene dimostrato come la presunta irregolarità dell'esito "an" in luogo di "a" davanti a consonante in alcuni tra i più antichi termini del lessico greco (tra cui mantis) sia in realtà da attribuirsi ad un esito originario "an", che accomunerebbe il greco antico alla maggior parte delle altre lingue sorelle indoeuropee antiche, dall'ittita al frigio, dall'antico irlandese all'armeno, dal bretone al celtiberico, ecc. Già l…

sonante nasalegreco antico.fonologia diacronicaisoglossa indoeuropea
researchProduct

Production of word structures : a constraint-based study of 2;6 year old Finnish children at-risk for dyslexia and their controls

2003

This study investigates Finnish children's phonological acquisition from a constraint-based account. An aim was to construct a hierarchical model in which different levels from word, syllable, phonotactic through to phoneme level were taken into account. The model is implicatory indicating that prosodic elements govern phonotactical and phoneme level elements in the acquisition of word structures. Secondly, a purpose was to compare children at-risk for dyslexia (N=105) and their controls (N=91) in order to find possible early precursors of familial dyslexia. In addition, subgroups of late talkers were studied in order to explore the developmental aspect of acquisition of word structures. Cr…

suomen kielikielellinen kehityspuheentuottolasten kehityskielen omaksuminendysleksiafonologialapset
researchProduct

Kiinalaisen aikuisopiskelijan suomen kielen fonologian oppiminen

2005

suomen kielioppiminentransferenssikiinan kielifonologia
researchProduct

Kielitaito ja psykolingvistiset taidot suomi toisena kielenä -lukemisen ja -kirjoittamisen selittäjinä

2022

The study investigated young learners of Finnish as L2 from Russian-speaking families mostly in grades 3–6 in Finnish-medium schools. 169 pupils completed language tests in Finnish and Russian, and psycholinguistic measures of basic linguistic processes related to phonological awareness, retrieval of words from memory, and working memory. The study examined to what extent linguistic and psycholinguistic skills predict learners’ Finnish L2 reading and writing. Regression analyses indicated that psycholinguistic factors (particularly processing Finnish phonemes) accounted for about 34% of variance in L2 reading and 38% in writing, whereas measures of language skills, mostly L2 skills (e.g., d…

suomen kielipsykolingvistiikkakielitaitosuomi toisena kielenäkielen oppiminentyömuistilukeminenfonologinen tietoisuuskirjoittaminen
researchProduct

Study in children with reading disabilities and familial risk for dyslexia and Russian second-language

2013

suomen kielisecond-language learningFinnishvenäjänkielisetRussiansuomi toisena kielenäkvantiteettiphonemic lengthprosediikkafoneemitquantityspeech perceptionoppimispelitoppimisvaikeudetdyslexiadysleksiakielen oppiminenlukihäiriötpuheen ymmärtäminenfonologialapset
researchProduct

Thermoelectric radiation detector based on a superconductor-ferromagnet junction : Calorimetric regime

2018

We study the use of a thermoelectric junction as a thermal radiation detector in the calorimetric regime, where single radiation bursts can be separated in time domain. We focus especially on the case of a large thermoelectric figure of merit ZT affecting significantly, for example, the relevant thermal time scales. This work is motivated by the use of hybrid superconductor/ferromagnet systems in creating an unprecedentedly high low-temperature ZT even exceeding unity. Besides constructing a very general noise model which takes into account cross correlations between charge and heat noise, we show how the detector signal can be efficiently multiplexed by the use of resonant LC circuits givi…

superconducting filmsthermodynamic measurements and instrumentationradiation detectorssignaalinkäsittelyilmaisimetinductorsferromagnetic materialsquasiparticlelämpösäteilytelecommunications engineeringfononitsuprajohteet
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Electron-phonon interaction in flat-band superconductivity

2017

Parhaiten tunnettu suprajohtavuuden syntymekanismi perustuu fononien välittämään vetovoimaan elektronien välillä. Tässä tutkielmassa tutkin fononien välittämää suprajohtavuutta systeemeissä, jossa elektronivyöt ovat tasomaisia. Tasovyöllä elektronien dispersio on erittäin heikko, jolloin tilatiheys on tavanomaista suurempi. Tämän takia suprajohtavuus tasovyöllä on tavanomaista voimakkaampi silloin kun elektronien välinen vetovoima on heikko. Eliashbergin teoria on elektroni–fononi-suprajohtavuuden teoria, joka ottaa luonnollisella tavalla fononien äärellisen nopeuden huomioon elektronien välisessä vuorovaikutuksessa. Pohjustuksena tasovyösuprajohtavuuteen perehdyn Eliashbergin teoriaan ensi…

suprajohtavuussuperconductivityflat bandelektroni-fononi-vuorovaikutusromboedrinen grafiittielektronitpintatilattasovyörombohedral graphiteEliashbergin teoriaelectron-phonon interactionsurface statesEliashberg theoryfononit
researchProduct

Ulkomaalaiset aikuisopiskelijat ja suomen liikeverbien rektiot ja astevaihtelut

1999

suuntaiset ja lokaaliset liikeverbitsyntaktisia ilmiöitäverbitkielenopetuskielen rakennesuomi toisena kielenärektioliikeverbitkielentutkimuksen alueetsanaluokatsuomi vieraana kielenätaivutusastevaihtelusyntaksifonologia
researchProduct

Comunicar : revista científica iberoamericana de comunicación y educación

2016

El ciberacoso es un fenómeno de creciente preocupación social que afecta cada vez más a niños y adolescentes de todos los paí- ses desarrollados. A diferencia de la considerable literatura que hay sobre las relaciones entre el acoso escolar y el contexto familiar y escolar, todavía hay pocos trabajos sobre la influencia de estos entornos sociales en el problema del ciberacoso. Mediante una metodología cuantitativa, el objetivo principal del presente estudio fue analizar la influencia del contexto escolar y familiar en víctimas de ciberacoso. La muestra estuvo formada por 1.062 adolescentes (51,5% chicos y 48,5% chicas), de edades comprendidas entre los 12 y los 18 años (M=14,5; DT=1,62). Se…

tecnología de la informaciónSchoolCultural StudiesSchool climateTeléfono móvileducationadolescente050801 communication & media studiesFamily conflictCyberbullyingEducationDevelopmental psychology0508 media and communicationsambiente escolarCiberacosoSelf-esteemnuevas tecnologíasVíctimasFamilyTeacher supportInternetVictimsciberacosoCommunicationQuantitative methodology05 social sciencesniñoAutoestima050301 educationacoso escolarsocial sciencesAdolescenceambiente familiarAdolescenciaEscuelaFamiliaPsychologyMobile phone0503 educationComunicar
researchProduct