Search results for "FREQUENCY"

showing 10 items of 2158 documents

Interaction between gene variants of the serotonin transporter promoter region (5-HTTLPR) and catecholO-methyltransferase (COMT) in borderline person…

2008

Borderline personality disorder (BPD) is characterized by a heterogeneous symptomatology with instability in impulse control, interpersonal relationships and self-image. BPD patients display repeated self-injury, chronic suicidal tendencies and emotional dysregulation, mainly dysregulation of negative affect. In its etiology, genetic and environmental factors have been suggested. Recently, an investigation in male healthy volunteers found gene–gene effects of the catechol-O-methyl-transferase (COMT) low-activity (Met158) and the low-expression allele of the deletion/insertion (short/long or S/L, respectively) polymorphism in the serotonin transporter-linked promoter region (5-HTTLPR) on the…

AdultMalemedicine.medical_specialtySingle-nucleotide polymorphismCatechol O-MethyltransferasePolymorphism Single Nucleotidebehavioral disciplines and activitiesCellular and Molecular NeuroscienceGene FrequencyGene interactionBorderline Personality DisorderInternal medicinemental disordersGenotypemedicineHumansAllelePromoter Regions GeneticBorderline personality disorderAllelesGenetics (clinical)Serotonin transporterSerotonin Plasma Membrane Transport ProteinsGeneticsCatechol-O-methyl transferasebiologybusiness.industryMiddle Agedmedicine.diseasePsychiatry and Mental healthLogistic ModelsEndocrinology5-HTTLPRbiology.proteinFemalebusinessAmerican Journal of Medical Genetics Part B: Neuropsychiatric Genetics
researchProduct

Measuring postural-related changes of spontaneous baroreflex sensitivity after repeated long-duration diving: Frequency domain approaches

2012

Sustained water immersion is thought to modulate orthostatic tolerance to an extent dependent on the duration and repetition over consecutive days of the diving sessions. We tested this hypothesis investigating in ten healthy subjects the potential changes in the cardiovascular response to head-up tilt induced by single and multiple resting air dives. Parametric cross-spectral analysis of spontaneous RR interval and systolic arterial pressure variability was performed in three experimental sessions: before diving (BD), after single 6-hour dive (ASD), and after multiple 6-hour dives (AMD, 5 consecutive days with 18-hour surface interval). From this analysis, baroreflex sensitivity (BRS) was …

AdultMalemedicine.medical_specialtySupine positionDivingPostureRR intervalOrthostatic intoleranceBaroreflexSensitivity and SpecificityEndocrine and Autonomic SystemCellular and Molecular NeuroscienceOrthostatic vital signsInternal medicinemedicineHumansShort durationAnalysis of VarianceElectronic Data ProcessingEndocrine and Autonomic Systemsbusiness.industrySpectrum AnalysisHead-up tiltBaroreflexCardiovascular variabilitymedicine.diseaseCausal coherenceParametric cross-spectral analysiFrequency domainSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaPower ratioCardiologyNeurology (clinical)businessOrthostatic toleranceAutonomic Neuroscience
researchProduct

Lack of association of the -463 G/A myeloperoxidase promoter polymorphism with Behcet's disease in Italian patients.

2007

Objective. To investigate potential associations between the � 463G/A myeloperoxidase (MPO) promoter polymorphism and susceptibility to, and clinical expression of, Behcet's disease (BD). Methods. One hundred and seventy-five Italian patients who satisfied the International Study Group criteria for BD and 235 healthy age- and sex-matched blood donors were genotyped for the �463G/A promoter polymorphism of the MPO gene by molecular methods. The patients were subgrouped according to the presence or absence of clinical manifestations. Results. The distribution of allele and genotype frequencies of the MPO �463A/G polymorphism did not differ significantly between the BD patients and the healthy…

AdultMalemedicine.medical_specialtySystemic diseaseAdult; Behcet Syndrome; Female; Gene Frequency; Genetic Predisposition to Disease; Genotype; Heterozygote; Histocompatibility Testing; Humans; Male; Peroxidase; Promoter Regions Genetic; Polymorphism GeneticHeterozygoteGenotypeBehcet's diseaseBehçet's disease; Disease manifestation; Myeloperoxidase; Myeloperoxidase gene polymorphism; Adult; Behcet Syndrome; Female; Gene Frequency; Genetic Predisposition to Disease; Genotype; Heterozygote; Histocompatibility Testing; Humans; Male; Peroxidase; Promoter Regions Genetic; Polymorphism Genetic; Rheumatology; Pharmacology (medical)Promoter RegionsRheumatologyGeneticGene FrequencyInternal medicineGenotypemedicineHumansPharmacology (medical)Genetic Predisposition to DiseaseAllelePolymorphismPromoter Regions GeneticPeroxidasePolymorphism Geneticbiologybusiness.industryBehcet SyndromeHistocompatibility TestingOdds ratiomedicine.diseaseRheumatologyGenotype frequencyMyeloperoxidaseImmunologybiology.proteinFemalebusinessRheumatology (Oxford, England)
researchProduct

The Intracranial Distribution of Gliomas in Relation to Exposure From Mobile Phones: Analyses From the INTERPHONE Study

2016

When investigating the association between brain tumors and use of mobile telephones, accurate data on tumor position are essential, due to the highly localized absorption of energy in the human brain from the radio-frequency fields emitted. We used a point process model to investigate this association using information that included tumor localization data from the INTERPHONE Study (Australia, Canada, Denmark, Finland, France, Germany, Israel, Italy, Japan, New Zealand, Norway, Sweden, and the United Kingdom). Our main analysis included 792 regular mobile phone users diagnosed with a glioma between 2000 and 2004. Similar to earlier results, we found a statistically significant association …

AdultMalemedicine.medical_specialtyTELEPHONENeoplasms Radiation-InducedTime FactorsEpidemiologyOriginal ContributionsTumor burdenBrain tumorAudiologyMOBILE TELEPHONES03 medical and health sciences0302 clinical medicinePhoneRisk FactorsRecall biasEXPOSITION AU RISQUECERVEAUMedicineHumans030212 general & internal medicineEpidemiologic researchSelf reportONDERADIO-FREQUENCY ELECTROMAGNETIC FIELDSbusiness.industryBrain NeoplasmsINTERPHONE STUDYMiddle Agedmedicine.diseaseTumor BurdenMobile phone030220 oncology & carcinogenesisEpidemiologic Research DesignGLIOMAFemale[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologieSPATIAL POINT PATTERNNeoplasm GradingbusinessINTRACRANIAL DISTRIBUTIONCell PhoneTUMEUR
researchProduct

Body weight changes and the A-6G polymorphism of the angiotensinogen gene

2002

BACKGROUND: The objective of the study was to analyze the relationship of polymorphisms of the angiotensinogen gene with changes in body weight during 3 y of antihypertensive treatment, in a group of young adults with essential hypertension. METHODS: Essential hypertensives, less than 50 y old, never previously treated with antihypertensive drugs and in the absence of diabetes mellitus were included. After the initial evaluation, patients were treated using only non-pharmacological measures (n=29), β-blockers (n=40) or angiotensin-converting enzyme inhibitors (n=66). Resting blood pressure, biochemical profile and body weight at the beginning and yearly were measured. The polymorphism A-6G …

AdultMalemedicine.medical_specialtyTime FactorsGenotypeEndocrinology Diabetes and MetabolismAdrenergic beta-AntagonistsAngiotensinogenMedicine (miscellaneous)Angiotensin-Converting Enzyme InhibitorsEssential hypertensionBody Mass IndexGene FrequencyPolymorphism (computer science)Diabetes mellitusInternal medicineGenotypeHumansMedicineAllele frequencyAntihypertensive AgentsAnalysis of VariancePolymorphism GeneticNutrition and Dieteticsbusiness.industryBody WeightMiddle Agedmedicine.diseaseBlood pressureEndocrinologyHypertensionFemalemedicine.symptombusinessBody mass indexWeight gainFollow-Up StudiesInternational Journal of Obesity
researchProduct

Choice of spatial frequency for contrast sensitivity evaluation after corneal refractive surgery.

2002

ABSTRACT PURPOSE: To study the utility of measurements of contrast sensitivity at different spatial frequencies as an index of visual recovery following refractive surgery. METHODS: Contrast sensitivity at 1.5, 3, 6, 12, and 18 c/deg was measured with the Stereo Optical FACT chart in 20 patients after photorefractive keratectomy (PRK) using the Nidek EC-5000 excimer laser system, and in 18 patients following laser in situ keratomileusis (LASER). Contrast sensitivity was measured preoperatively and 1, 3, 6, and 12 months after surgery. RESULTS: Results showed a statistically significant reduction (P<01) in contrast sensitivity at all spatial frequencies in PRR patients during the first an…

AdultMalemedicine.medical_specialtyTime Factorsgenetic structuresmedicine.medical_treatmentmedia_common.quotation_subjectKeratomileusis Laser In SituVisual AcuityKeratomileusisExcimerPhotorefractive Keratectomylaw.inventionContrast SensitivityCornealawOphthalmologyRefractive surgerymedicineMyopiaContrast (vision)Humansmedia_commonbusiness.industryLASIKLasereye diseasesPhotorefractive keratectomySurgeryOphthalmologySurgeryFemaleLasers Excimersense organsSpatial frequencybusinessJournal of refractive surgery (Thorofare, N.J. : 1995)
researchProduct

Clinical observations and risk factors for tinnitus in a Sicilian cohort.

2014

The aims of this study were to determine the distribution of risk factors associated with tinnitus analysing their role in the development of tinnitus and the effects of their interaction; to evidence the importance of a suitable and adequate clinical and audiologic assessment to avoid those modifiable risk factors responsible for cochlear dysfunction and tinnitus onset. 46 subjects with tinnitus and 74 controls were studied according to: age, sex, Body Mass Index (BMI), neck circumference, tobacco smoking, feeling fatigue or headache, self reporting snoring, hypertension, diabetes, coronary heart disease, and/or hyperlipidemia, and laboratory finding as lipid profile and levels of reactive…

AdultMalemedicine.medical_specialtyTinnitus Hearing loss Risk factors Multi-frequency audiometry TEOAEAdolescentHearing lossOtoacoustic Emissions SpontaneousAudiologyMulti-frequency audiometry TEOAERisk AssessmentTinnitusYoung AdultAudiometryRisk Factorsotorhinolaryngologic diseasesmedicinePrevalenceHumansSicilyAgedAged 80 and overUnivariate analysismedicine.diagnostic_testbusiness.industrySettore MED/44 - Medicina Del LavoroGeneral MedicineMiddle Agedmedicine.diseaseComorbiditySettore MED/32 - AudiologiaSettore MED/31 - OtorinolaringoiatriaOtorhinolaryngologyCohortTinnitus Hearing loss Risk factorFemalemedicine.symptomAudiometrybusinessLipid profileBody mass indexTinnitusFollow-Up StudiesEuropean archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery
researchProduct

Differences in visual performance of AcrySof ReSTOR IOL in high and low myopic eyes.

2009

PURPOSE To determine the differences in refractive and visual results obtained in eyes with high and low myopia after multifocal intraocular lens (IOL) implantation. METHODS Monocular visual acuity for distance and near, with and without distance correction, and photopic and mesopic contrast sensitivity were measured at 6 months after surgery in 152 myopic eyes implanted with the AcrySof ReSTOR Natural (SN60D3) IOL. Two groups were created: high and low myopia (76 eyes in each). RESULTS Monocular best distance-corrected visual acuity was 0.02+/-0.06 logMAR for low myopes and 0.05+/-0.09 logMAR for high myopes. Monocular best distance-corrected near visual acuity was 0.04+/-0.05 and 0.07+/-0…

AdultMalemedicine.medical_specialtyVisual acuitygenetic structuresPseudophakiaMesopic visionmedia_common.quotation_subjectProsthesis DesignRefraction OcularSeverity of Illness IndexContrast Sensitivity03 medical and health sciences0302 clinical medicineLens Implantation IntraocularOphthalmologymedicineMyopiaContrast (vision)HumansProspective Studiesmedia_commonAgedLenses IntraocularMonocularbusiness.industryGeneral MedicineMultifocal intraocular lensMiddle AgedDistance correctioneye diseasesOphthalmologyTreatment Outcome030221 ophthalmology & optometryFemalesense organsSpatial frequencymedicine.symptombusiness030217 neurology & neurosurgeryPhotopic visionEuropean journal of ophthalmology
researchProduct

Sex differences in allelic frequencies of the 5-HT2C Cys23Ser polymorphism in psychiatric patients and healthy volunteers: findings from an associati…

2000

Polymorphisms in the serotonergic system are believed to play a role in the etiology and treatment of different psychiatric illnesses. The 5-HT2C receptor gene is X-linked, with a frequent mutation at nucleotide 68 leading to a Ser-->Cys transition at amino acid 23. Recent studies have demonstrated an impaired function of 5-HT2C receptors and an increased production of the major noradrenergic metabolite 3-methoxy-4-hydroxyphenylethyleneglycol in the cerebrospinal fluid among the subjects carrying the Ser23 allele (Lappalainen et al., 1999). Biol. Psychiatry 46:821). We genotyped patients with alcohol dependence, panic disorder without agoraphobia, generalized anxiety disorder, narcolepsy an…

AdultMalemedicine.medical_specialtyX ChromosomeGeneralized anxiety disorderGene FrequencyReference ValuesGenotypeReceptor Serotonin 5-HT2CSerineGeneticsmedicineHumansCysteineAllelePsychiatryAllele frequencyAllelesBiological PsychiatryGenetics (clinical)NarcolepsySex CharacteristicsPolymorphism Geneticbusiness.industryMental DisordersPanic disorderAlcohol dependenceMiddle Agedmedicine.diseaseAnxiety DisordersAlcoholismPsychiatry and Mental healthAmino Acid SubstitutionReceptors SerotoninPanic DisorderFemalebusinessAgoraphobiaNarcolepsyPsychiatric Genetics
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct